Plant Peptides intermediate
Bowman-Birk Inhibitor: Oligopeptide Research Reference
Bowman-Birk Inhibitor, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Bowman-Birk Inhibitor is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Glycine max (Soybean).
Structure
| Property | Value |
|---|---|
| Name | Bowman-Birk Inhibitor |
| Sequence | DVPLDVAQTFHLKPFCSLCLPGNKCDTCLKS |
| Length | 71 amino acids |
| Molecular Weight | ~8,000 Da |
| Source | Glycine max (Soybean) |
| Category | Plant Bioactive Peptides |
Mechanism of Action
Double-headed protease inhibitor binding both trypsin and chymotrypsin simultaneously
Bioactivity
Protease inhibitor, anti-cancer, anti-inflammatory
Therapeutic Potential
Cancer chemoprevention, COPD therapy, anti-inflammatory treatment
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Bowman-Birk Inhibitor: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept