Skip to content

Oligopeptide Database

6517 peptides

17 OH Progesterone Hormone: Comprehensive Peptide Reference

17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...

Peptide Hormones intermediate

17 OH Progesterone Peptide Hormone

17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...

Peptide Hormones intermediate

17 OH Progesterone Protein Hormone

17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...

Peptide Hormones intermediate

2-Aminoethoxy: Oligopeptide Research Reference

Comprehensive reference for 2-aminoethoxy, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

2-Fluoro RNA: Oligopeptide Research Reference

Comprehensive reference for 2-fluoro rna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

2-O-methyl RNA: Oligopeptide Research Reference

Comprehensive reference for 2-o-methyl rna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

2D PAGE Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using 2D PAGE. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

3D Printing Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using 3D Printing for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

3D-Printed Peptide Delivery: Comprehensive Peptide Reference

Explore additive manufacturing of personalized peptide drug delivery devices with complex release profiles. This peptide or oligopeptide is studied for its b...

Drug Delivery advanced

3D-printing for Peptides: Analytical Technique in Peptide...

Application of 3D-printing technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...

Structural Biology Techniques advanced

4 1BB Agonist: Oligopeptide Research Reference

4 1BB agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

A Baumannii Peptide: Oligopeptide Research Reference

A peptide associated with A Baumannii for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

A Baumannii Xdr Peptide: Oligopeptide Research Reference

A peptide associated with A Baumannii Xdr for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...

Microbial Peptides intermediate

AAPPTec Apex: Oligopeptide Research Reference

Advanced automated peptide synthesizer for solid-phase peptide synthesis with high-throughput capabilities. This peptide or oligopeptide is studied for its b...

Peptide Research Tools intermediate

Ab Initio for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using Ab Initio. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

Abaloparatide SC: Oligopeptide Research Reference

PTHrP(1-34) analog for postmenopausal osteoporosis with preferential PTH1R anabolic activation. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs intermediate

Abaloparatide: Oligopeptide Research Reference

Synthetic PTHrP analog that preferentially activates RG signaling for osteoporosis treatment with less hypercalcemia than teriparatide.

Bone-Active Peptides intermediate

Abaloparatide: Oligopeptide Research Reference

Synthetic analog of PTHrP(1-34) used for osteoporosis treatment, promotes bone formation via PTH1R activation. This peptide or oligopeptide is studied for it...

Peptide Analogs intermediate

Abatacept: Oligopeptide Research Reference

abatacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

AbbVie: Therapeutic Peptide Drug Profile

Global biopharmaceutical company specializing in immunology, oncology, and neuroscience peptide therapeutics including leuprolide.

Peptide Patents intermediate

Abciximab: Oligopeptide Research Reference

abciximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

ABL Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting ABL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Abrin: Peptide Toxin in Pharmacology Reference

Abrin is a highly toxic ribosome-inactivating protein from jequirity beans (Abrus precatorius) that inhibits protein synthesis, closely related to ricin in s...

Toxin Peptides advanced

accuracy Resource: Oligopeptide Research Reference

The accuracy database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

ACE Inhibitor: Enzyme in Peptide Biology Reference

ACE inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifici...

Enzyme Peptides intermediate

Ace-AMP1: Oligopeptide Research Reference

Ace-AMP1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

ACE-Inhibitory Peptides (General)

Comprehensive reference for ACE-Inhibitory Peptides (General), a peptide compound with applications in research and therapeutics.

Food Peptides intermediate

Acetone Precipitation Purification

A purification technique for separating and isolating peptides using Acetone Precipitation. This analytical technique provides valuable insights into peptide...

Purification Methods advanced

Acetyl Carnosine: Oligopeptide Research Reference

acetyl-carnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Acetyl Hexapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-NH₂)

Comprehensive reference for Acetyl Hexapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-NH₂), a peptide compound with applications in research and therapeutics.

Cosmetic Peptides intermediate

Acetyl Hexapeptide-3 (Argireline)

Comprehensive reference for Acetyl Hexapeptide-3 (Argireline), a peptide compound with applications in research and therapeutics.

Synthetic Peptides intermediate

Acetyl Octapeptide-3 (SNAP-8): Comprehensive Peptide Refe...

Comprehensive reference for Acetyl Octapeptide-3 (SNAP-8), a peptide compound with applications in research and therapeutics.

Synthetic Peptides intermediate

Acetylation (Lys): Post-Translational Modification Reference

Acetylation (Lys), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Modifications intermediate

Acetyltransferase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Acetyltransferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide-Drug Conjugates advanced

Acid Labile Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Acid Labile. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

Acidic MPLA2: Peptide Toxin in Pharmacology Reference

acidic-MPLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...

Venom Peptides intermediate

ACS Medicinal Chemistry: Oligopeptide Research Reference

American Chemical Society journal focused on medicinal chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

ACTH (Adrenocorticotropic hormone)

Comprehensive reference for ACTH (Adrenocorticotropic hormone), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

ACTH 1-10: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-13: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-18: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-24: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-39: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 1-39 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-4: Adrenocorticotropic Hormone Fragment in Peptide...

Comprehensive reference for ACTH 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 1-8: Adrenocorticotropic Hormone Fragment in Peptide...

Comprehensive reference for ACTH 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 11-24: Adrenocorticotropic Hormone Fragment in Pepti...

Comprehensive reference for ACTH 11-24 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 18-39: Adrenocorticotropic Hormone Fragment in Pepti...

Comprehensive reference for ACTH 18-39 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 3-18: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 3-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 4-10: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 4-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH 7-18: Adrenocorticotropic Hormone Fragment in Peptid...

Comprehensive reference for ACTH 7-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

ACTH Family Peptides: Oligopeptide Research Reference

Guide to ACTH family peptides including ACTH, MSH, and lipotropin in adrenal and melanocortin signaling. This peptide or oligopeptide is studied for its biol...

Peptide Families intermediate

ACTH Hormone: Endogenous Peptide Hormone Reference

ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

ACTH Peptide Hormone: Endogenous Peptide Hormone Reference

ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

ACTH Protein Hormone: Endogenous Peptide Hormone Reference

ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

Actin capping: Oligopeptide Research Reference

Comprehensive reference for actin capping, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin crosslinking: Oligopeptide Research Reference

Comprehensive reference for actin crosslinking, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin depolymerization: Oligopeptide Research Reference

Comprehensive reference for actin depolymerization, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin filament: Oligopeptide Research Reference

Comprehensive reference for actin filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin nucleation: Oligopeptide Research Reference

Comprehensive reference for actin nucleation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin polymerization: Oligopeptide Research Reference

Comprehensive reference for actin polymerization, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Actin severing: Oligopeptide Research Reference

Comprehensive reference for actin severing, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Activation: Oligopeptide Research Reference

Receptor/enzyme stimulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Interactions intermediate

Active: Oligopeptide Research Reference

Active is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Research Tools intermediate

Activin A Antagonist: Oligopeptide Research Reference

activin A antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Reproductive Peptides intermediate

Activin A: Endogenous Peptide Hormone Reference

activin-A is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Activin AB: Endogenous Peptide Hormone Reference

activin-AB is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Activin B: Endogenous Peptide Hormone Reference

activin-B is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Activin C: Endogenous Peptide Hormone Reference

activin-C is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Activin/TGF-β Trap: Oligopeptide Research Reference

Activin/TGF-β Trap is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological...

Peptide Clinical Trials intermediate

Adalimumab: Oligopeptide Research Reference

adalimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Adaptive Biasing for Peptides: Comprehensive Peptide Refe...

A computational method for studying peptides using Adaptive Biasing. This analytical technique provides valuable insights into peptide structure, purity, and...

Computational Methods advanced

ADDMADMSTLADDLAC: Oligopeptide Research Reference

Microcystis aeruginosa. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Protist Peptides intermediate

Adhd Peptides: Oligopeptide Research Reference

Peptides associated with Adhd including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...

Disease-Associated Peptides intermediate

Adipokinetic Hormone: Oligopeptide Research Reference

Adipokinetic Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Adiponectin 1-20: Peptide Fragment Reference

Comprehensive reference for adiponectin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin 1-30: Peptide Fragment Reference

Comprehensive reference for adiponectin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin 1-40: Peptide Fragment Reference

Comprehensive reference for adiponectin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin full-length-1-244: Comprehensive Peptide Refe...

Comprehensive reference for adiponectin full-length-1-244 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin globular-1-150: Comprehensive Peptide Reference

Comprehensive reference for adiponectin globular-1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin globular-100-150: Comprehensive Peptide Refer...

Comprehensive reference for adiponectin globular-100-150 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin globular-120-150: Comprehensive Peptide Refer...

Comprehensive reference for adiponectin globular-120-150 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Adiponectin Hormone: Endogenous Peptide Hormone Reference

Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Adiponectin Peptide Hormone: Comprehensive Peptide Reference

Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Adiponectin Protein Hormone: Comprehensive Peptide Reference

Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Adiponectin: Oligopeptide Research Reference

Adiponectin is a 244-amino acid adipokine that enhances insulin sensitivity, exerts anti-inflammatory effects, and protects against cardiovascular disease th...

Metabolic intermediate

Adrenomedullin 2: Neuropeptide in Neuroscience Reference

adrenomedullin-2 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its bi...

Neuropeptides intermediate

Adrenomedullin 22 52: Neuropeptide in Neuroscience Reference

adrenomedullin-22-52 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for it...

Neuropeptides intermediate

Adrenomedullin 22 52: Oligopeptide Research Reference

adrenomedullin 22 52 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Cardiovascular Peptides intermediate

Adrenomedullin Hormone: Endogenous Peptide Hormone Reference

Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Adrenomedullin Peptide Hormone

Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Adrenomedullin Protein Hormone

Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Adrenomedullin: Oligopeptide Research Reference

52-amino acid vasodilator peptide with potent hypotensive, natriuretic, and cardioprotective properties. This peptide or oligopeptide is studied for its biol...

Cardiovascular Peptides intermediate

Aducanumab: Oligopeptide Research Reference

Aducanumab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Advanced Analytics in Peptide Drug Development

Application of advanced statistical and data analytics methods to peptide drug development. This peptide or oligopeptide is studied for its biological activi...

Data Science advanced

Advanced Modeling in Peptide Drug Development

Computational modeling approaches for predicting peptide drug properties. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Computational Sciences advanced

adverse-event Resource: Oligopeptide Research Reference

The adverse-event database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...

Databases & Resources intermediate

aerogel for Peptides: Analytical Technique in Peptide Res...

Application of aerogel technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...

Structural Biology Techniques advanced

Afamelanotide: Oligopeptide Research Reference

Synthetic alpha-MSH analog for erythropoietic protoporphyria promoting melanogenesis for photoprotection. This peptide or oligopeptide is studied for its bio...

Peptide Drugs intermediate

Affinity Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using Affinity. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

Affinity Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using Affinity. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

Affinity Purification: Oligopeptide Research Reference

Affinity Purification, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

AFM for Peptide Imaging: Analytical Technique in Peptide ...

Explore atomic force microscopy for high-resolution imaging of peptide morphology and self-assembly on surfaces. Covers molecular mechanisms, biological acti...

Peptide Analysis advanced

AFM for Peptides: Analytical Technique in Peptide Research

Application of AFM technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...

Structural Biology Techniques advanced

AFM: Oligopeptide Research Reference

µg. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...

Peptide Technologies intermediate

Agalsidase Beta: Oligopeptide Research Reference

Agalsidase Beta, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Agalsidase: Oligopeptide Research Reference

agalsidase in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Agilent 1260 Infinity II: Oligopeptide Research Reference

HPLC system for peptide analysis. Binary/quaternary pump, autosampler, DAD detector. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Therapeutics intermediate

Agilent 6545 Q-TOF: Oligopeptide Research Reference

Quadrupole time-of-flight mass spectrometer. High-resolution accurate mass for peptide identification. This peptide or oligopeptide is studied for its biolog...

Peptide Therapeutics intermediate

Aging and Defensins: Antimicrobial Peptide Reference

Age-related changes in AMP expression contributing to increased infection in elderly. This antimicrobial peptide demonstrates activity against pathogens and ...

Antimicrobial Peptides intermediate

Aging and Peptides: Oligopeptide Research Reference

Explore anti-aging peptide therapies including thymic peptides, telomerase activators, and senolytic peptides. This peptide or oligopeptide is studied for it...

Peptide Therapeutics intermediate

Agitoxin-2: Oligopeptide Research Reference

38-residue peptide from Leiurus quinquestriatus scorpion venom. Blocks voltage-gated potassium channels (Kv1.1, Kv1.2, Kv1.3).

Peptide Therapeutics intermediate

Agouti-Related Peptide: Neuropeptide in Neuroscience Refe...

A 113-amino acid neuropeptide co-expressed with NPY in the arcuate nucleus that antagonizes melanocortin receptors (MC3R/MC4R), stimulating appetite and oppo...

Neuropeptides intermediate

Agricultural Peptide Market: Comprehensive Peptide Reference

Market analysis for agricultural peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Peptide Therapeutics intermediate

Agricultural Peptides: Crop Protection and Growth Enhance...

Explore peptide-based biopesticides and plant growth regulators for sustainable agriculture. This peptide or oligopeptide is studied for its biological activ...

Agricultural Peptides advanced

Agricultural: Oligopeptide Research Reference

Agricultural is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...

Peptide Applications intermediate

AI in Peptide Design: Oligopeptide Research Reference

How artificial intelligence is transforming peptide drug discovery and design optimization. This peptide or oligopeptide is studied for its biological activi...

Peptide Future intermediate

AI in Peptide Drug Discovery: Comprehensive Peptide Refer...

Application of artificial intelligence and machine learning to accelerate peptide drug discovery, design, and optimization.

Computational Peptides advanced

AI in Peptide Formulation Development

Application of artificial intelligence and machine learning to optimize peptide drug formulations. This peptide or oligopeptide is studied for its biological...

Formulation Development advanced

AI-Powered Peptide Design: Comprehensive Peptide Reference

Machine learning approaches including: generative models (VAE, GAN, diffusion), reinforcement learning for optimization, and deep learning for property predi...

Peptide Therapeutics intermediate

Aids Peptides: Oligopeptide Research Reference

Peptides associated with Aids including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...

Disease-Associated Peptides intermediate

Airway Surface Liquid Peptides

Antimicrobial peptides in airway surface liquid protecting against respiratory infections. This antimicrobial peptide demonstrates activity against pathogens...

Antimicrobial Peptides intermediate

AKRHHGYKRKFHEKHHSHRGY: Oligopeptide Research Reference

Human salivary gland. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...

Yeast Peptides intermediate

AKT Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting AKT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Alanine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Alanine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...

Amino Acid Metabolism intermediate

Alanine Modification: Post-Translational Modification Ref...

Post-translational modifications of Alanine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...

Amino Acid Modifications intermediate

Alanine Peptide: Oligopeptide Research Reference

Alanine (A) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...

Amino Acid Peptides beginner

ALBERT for Peptides: Analytical Technique in Peptide Rese...

A computational method for studying peptides using ALBERT. This analytical technique provides valuable insights into peptide structure, purity, and character...

Computational Methods advanced

Albiglutide Albumin Fusion: Comprehensive Peptide Reference

Albumin-GLP-1 fusion protein providing once-weekly GLP-1 receptor agonism through non-covalent albumin binding. Covers molecular mechanisms, biological activ...

GLP-1 Family intermediate

Albiglutide: Oligopeptide Research Reference

GLP-1 receptor agonist fused to human albumin for once-weekly type 2 diabetes treatment with reduced immunogenicity. Covers molecular mechanisms, biological ...

GLP-1 Analogs intermediate

Albiglutide: Oligopeptide Research Reference

Once-weekly GLP-1 agonist fused to human albumin via non-cleavable linker for extended half-life. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs intermediate

Albiglutide: Oligopeptide Research Reference

albiglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Albumin Binding System 1: Oligopeptide Research Reference

A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Albumin Binding System 2: Oligopeptide Research Reference

A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Albumin Binding System 3: Oligopeptide Research Reference

A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Albumin binding: Oligopeptide Research Reference

Comprehensive reference for albumin binding, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Aldafermin: Oligopeptide Research Reference

Aldafermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Aldesleukin: Oligopeptide Research Reference

Recombinant interleukin-2 for metastatic renal cell carcinoma and melanoma, stimulating T-cell and NK cell proliferation.

Immunomodulatory Peptides advanced

Aldosterone Hormone: Endogenous Peptide Hormone Reference

Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Aldosterone Peptide Hormone: Comprehensive Peptide Reference

Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Aldosterone Protein Hormone: Comprehensive Peptide Reference

Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Alefacept: Oligopeptide Research Reference

alefacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Alemtuzumab: Oligopeptide Research Reference

alemtuzumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Alexandrium catenella: Oligopeptide Research Reference

Blocks Na+ channel pore (site 1). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Protist Peptides intermediate

Alfentanil Short-Acting: Neuropeptide in Neuroscience Ref...

Short-acting synthetic opioid with faster onset than fentanyl. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides intermediate

Alfentanil: Oligopeptide Research Reference

Alfentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Aliskiren: Oligopeptide Research Reference

First direct renin inhibitor for hypertension, blocking the rate-limiting step of the renin-angiotensin-aldosterone system.

Cardiovascular Peptides intermediate

ALK Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting ALK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Alkyne Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using Alkyne. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

All Atom for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using All Atom. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

All except APD3 and WHO ICTRP: Comprehensive Peptide Refe...

Data Type. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...

Peptide Databases intermediate

All research peptides: Oligopeptide Research Reference

Strategy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...

Synthetic Peptides intermediate

Allatostatin: Oligopeptide Research Reference

Allatostatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Allatotropin: Oligopeptide Research Reference

Allatotropin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Allergy / Birch Pollen: Oligopeptide Research Reference

Allergy / Birch Pollen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Peptide Vaccines intermediate

Allergy / Grass Pollen: Oligopeptide Research Reference

Allergy / Grass Pollen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Peptide Vaccines intermediate

Almond Peptide: Oligopeptide Research Reference

A bioactive peptide derived from almond with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Alpha cobratoxin: Structure, Function, and Significance

Alpha-cobratoxin is a potent postsynaptic neurotoxin from cobra venom that blocks nicotinic acetylcholine receptors. Covers molecular mechanisms, biological ...

Venom Peptides intermediate

Alpha Conotoxin AuIB: Peptide Toxin in Pharmacology Refer...

alpha-conotoxin-AuIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Alpha Conotoxin GIIA: Peptide Toxin in Pharmacology Refer...

alpha-conotoxin-GIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Alpha Conotoxin ImI: Peptide Toxin in Pharmacology Reference

alpha-conotoxin-ImI is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolo...

Venom Peptides intermediate

Alpha Conotoxin PnIB: Peptide Toxin in Pharmacology Refer...

alpha-conotoxin-PnIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Alpha Conotoxin Vc1.1: Peptide Toxin in Pharmacology Refe...

alpha-conotoxin-Vc1.1 is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its bio...

Venom Peptides intermediate

Alpha Defensin 1: Antimicrobial Peptide Reference

alpha-defensin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Alpha Defensin 2: Antimicrobial Peptide Reference

alpha-defensin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Alpha Defensin 3: Antimicrobial Peptide Reference

alpha-defensin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Alpha Defensin 4: Antimicrobial Peptide Reference

alpha-defensin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Alpha MSH Fragment: Oligopeptide Research Reference

alpha MSH fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Anti-inflammatory Peptides intermediate

Alpha Synuclein: Oligopeptide Research Reference

alpha synuclein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Diagnostic Peptides intermediate

Alpha-Bungarotoxin: Peptide Toxin in Pharmacology Reference

Alpha-bungarotoxin is a 74-amino acid three-finger neurotoxin from the banded krait snake that irreversibly blocks nicotinic acetylcholine receptors at the n...

Toxin Peptides advanced

Alpha-Calcitonin Gene-Related Peptide

Alpha-CGRP is a potent vasodilatory neuropeptide implicated in migraine pathophysiology and neurogenic inflammation through CLR/RAMP1 receptor signaling.

Vasoactive Peptides intermediate

Alpha-Conotoxin GI: Peptide Toxin in Pharmacology Reference

Short disulfide-rich peptide from Conus geographus blocking nicotinic acetylcholine receptors. This peptide toxin is derived from venom and studied for its p...

Venom Peptides intermediate

Alpha-Conotoxin MI: Peptide Toxin in Pharmacology Reference

Muscle-type nicotinic receptor antagonist from Conus magus with therapeutic potential. This peptide toxin is derived from venom and studied for its pharmacol...

Venom Peptides intermediate

Alpha-Conotoxin PnIA: Peptide Toxin in Pharmacology Refer...

Neuronal nicotinic receptor antagonist from Conus pennaceus with analgesic potential. This peptide toxin is derived from venom and studied for its pharmacolo...

Venom Peptides intermediate

Alpha-Conotoxin Synthetic: Comprehensive Peptide Reference

Solid-phase synthesis strategies for conotoxin production. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...

Venom Peptides intermediate

Alpha-Defensin Oligomerization

Oligomerization forming pore-like structures in bacterial membranes. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...

Antimicrobial Peptides advanced

Alpha-Endorphin: Neuropeptide in Neuroscience Reference

Shorter POMC-derived opioid with mu-opioid receptor activity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...

Neuropeptides intermediate

Alpha-Fetoprotein (AFP): Oligopeptide Research Reference

69 kDa glycoprotein, albumin superfamily. Produced by fetal liver and yolk sac. Binds estradiol, fatty acids. Normal adult: <10 ng/mL. HCC: >400 ng/mL (highl...

Peptide Therapeutics intermediate

Alpha-MSH (α-MSH): Neuropeptide in Neuroscience Reference

Alpha-MSH (α-MSH), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Alpha-MSH: Oligopeptide Research Reference

A 13-amino acid melanocortin peptide derived from proopiomelanocortin (POMC) that regulates pigmentation, appetite, and inflammation through melanocortin rec...

Peptide Hormones intermediate

Alpha-Neo-Endorphin: Neuropeptide in Neuroscience Reference

Prodynorphin-derived opioid with kappa-opioid activity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...

Neuropeptides intermediate

Alpha-Synuclein (α-Syn): Oligopeptide Research Reference

Alpha-Synuclein (α-Syn), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarker Peptides intermediate

Alpha-synuclein Aggregation (Self-association)

Comprehensive reference for Alpha-synuclein Aggregation (Self-association), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Alpha-synuclein aggregation: Comprehensive Peptide Reference

Comprehensive reference for alpha-synuclein aggregation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Alpha-synuclein: Oligopeptide Research Reference

140-aa presynaptic protein. Aggregates in Parkinson's and Lewy body dementia. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

AlphaFold Applications: Oligopeptide Research Reference

Applications include: drug target identification, binding site prediction, enzyme engineering, antibody design, protein-protein interaction modeling, and und...

Peptide Therapeutics intermediate

AlphaFold for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using AlphaFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

AlphaFold for Peptides: Oligopeptide Research Reference

Applying DeepMind's AlphaFold to peptide structure prediction and drug design. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Future advanced

AlphaFold Protein Structure Database

Open database of 200+ million predicted protein structures covering nearly all known proteins. Joint project of EMBL-EBI and DeepMind.

Peptide Therapeutics intermediate

AlphaFold: Oligopeptide Research Reference

DeepMind protein structure prediction. CASP14 winner (GDT 92.4). Nobel Prize 2024. 200M+ predicted structures. This peptide or oligopeptide is studied for it...

Peptide Therapeutics intermediate

AlphaLISA Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using AlphaLISA. This analytical technique provides valuable insights into peptide structure, purity, and...

Analytical Techniques advanced

AlphaScreen Analysis: Analytical Technique in Peptide Res...

An analytical technique for characterizing peptides using AlphaScreen. This analytical technique provides valuable insights into peptide structure, purity, a...

Analytical Techniques advanced

ALRN-5281: Oligopeptide Research Reference

ALRN-5281, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

ALRN-6924 - First-in-Human (NCT02264613)

First-in-human trial of ALRN-6924, a dual MDM2/MDMX inhibitor peptide. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Therapeutics intermediate

ALRN-6924 - MDM2/MDMX (NCT04022876)

Phase II trial of ALRN-6924 for MDM2/MDMX-driven cancers. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...

Peptide Therapeutics intermediate

ALRN-6924: Oligopeptide Research Reference

ALRN-6924, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Als Peptides: Oligopeptide Research Reference

Peptides associated with Als including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...

Disease-Associated Peptides intermediate

ALS: Oligopeptide Research Reference

Progressive motor neuron disease affecting both upper (cortical) and lower (spinal) motor neurons. Sporadic (90%) or familial (10%, SOD1, C9orf72, TARDBP, FU...

Peptide Therapeutics intermediate

Alyteserin-1: Antimicrobial Peptide Reference

Alyteserin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Alyteserin-2: Antimicrobial Peptide Reference

Alyteserin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Alytesin: Antimicrobial Peptide Reference

Alytesin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Alzheimer's and Peptides: Oligopeptide Research Reference

Explore peptide approaches to Alzheimer's disease including amyloid-targeting therapies and neuroprotective peptides. Covers molecular mechanisms, biological...

Peptide Therapeutics advanced

Alzheimer's Disease: Oligopeptide Research Reference

Alzheimer's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neurological intermediate

Alzheimers Peptides: Oligopeptide Research Reference

Peptides associated with Alzheimers including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Amanitin: Oligopeptide Research Reference

Amanitin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Amaranth Peptide: Oligopeptide Research Reference

A bioactive peptide derived from amaranth with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

Amb a 1 Immunostimulatory: Comprehensive Peptide Reference

Comprehensive reference for Amb a 1 Immunostimulatory, a peptide compound with applications in research and therapeutics.

Peptide Vaccines intermediate

American Peptide Symposium: Comprehensive Peptide Reference

Annual conference for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...

Peptide Therapeutics intermediate

Amide Bonds in Peptides: Post-Translational Modification ...

Guide to amide bond chemistry, the fundamental linkage in peptide and protein structures. This modification affects peptide stability, receptor binding, and ...

Peptide Modifications beginner

Amino Acid Analysis: Analytical Technique in Peptide Rese...

Guide to amino acid analysis methods for determining peptide composition and quantifying individual residues. This peptide or oligopeptide is studied for its...

Peptide Analysis beginner

Amorphous Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Amorphous for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

AMP Activity Database: Antimicrobial Peptide Reference

Curated MIC values, hemolytic activity, and cytotoxicity data. This antimicrobial peptide demonstrates activity against pathogens and is studied for its mech...

Antimicrobial Peptides intermediate

AMP Database APD: Antimicrobial Peptide Reference

Comprehensive public database with sequences, structures, and activity data. This antimicrobial peptide demonstrates activity against pathogens and is studie...

Antimicrobial Peptides beginner

AMP Drug Delivery: Antimicrobial Peptide Reference

Formulation strategies including nanoparticle encapsulation and hydrogel systems. This antimicrobial peptide demonstrates activity against pathogens and is s...

Antimicrobial Peptides advanced

AMP Immunomodulation: Antimicrobial Peptide Reference

Immunomodulatory functions including chemokine activity and cytokine induction. This antimicrobial peptide demonstrates activity against pathogens and is stu...

Antimicrobial Peptides advanced

AMP Resistance Mechanisms: Comprehensive Peptide Reference

Bacterial resistance strategies including protease secretion and membrane modification. This antimicrobial peptide demonstrates activity against pathogens an...

Antimicrobial Peptides advanced

AMP Structural Classification: Comprehensive Peptide Refe...

Classification into alpha-helical, beta-sheet, extended, and loop conformations. This antimicrobial peptide demonstrates activity against pathogens and is st...

Antimicrobial Peptides intermediate

AMP Therapeutics Development: Comprehensive Peptide Refer...

Clinical development of defensin-based therapeutics including topical formulations. This antimicrobial peptide demonstrates activity against pathogens and is...

Antimicrobial Peptides intermediate

Amphibian AMP Database: Antimicrobial Peptide Reference

Comprehensive database of over 1000 antimicrobial peptides from amphibian skin. This antimicrobial peptide demonstrates activity against pathogens and is stu...

Antimicrobial Peptides intermediate

Amphibian Antimicrobial: Antimicrobial Peptide Reference

Amphibian Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...

Amphibian Peptides intermediate

Amphibian Antiviral: Antimicrobial Peptide Reference

Amphibian Antiviral is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Amphibian Peptides intermediate

Amphibian Bradykinin: Antimicrobial Peptide Reference

Amphibian Bradykinin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Amphibian Peptides intermediate

Amphibian Caerulein: Antimicrobial Peptide Reference

Amphibian Caerulein is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Amphibian Peptides intermediate

Amphibian Neuropeptide: Antimicrobial Peptide Reference

Amphibian Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Amphibian Peptides intermediate

Amphibian Opioid: Antimicrobial Peptide Reference

Amphibian Opioid is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological a...

Amphibian Peptides intermediate

Amphipathic Helix Design: Antimicrobial Peptide Reference

Rational design based on hydrophobic moment and charge distribution. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...

Antimicrobial Peptides advanced

amphipathicity Resource: Oligopeptide Research Reference

The amphipathicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Amphotericin B: Oligopeptide Research Reference

Amphotericin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

AMPK Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

AMPK Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

AMPK Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

AMPK Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

AMPK Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Amylin 1-13: Peptide Fragment Reference

Comprehensive reference for amylin 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 1-17: Peptide Fragment Reference

Comprehensive reference for amylin 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 1-21: Peptide Fragment Reference

Comprehensive reference for amylin 1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 1-37: Peptide Fragment Reference

Comprehensive reference for amylin 1-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 1-8: Peptide Fragment Reference

Comprehensive reference for amylin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 17-21: Peptide Fragment Reference

Comprehensive reference for amylin 17-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 17-37: Peptide Fragment Reference

Comprehensive reference for amylin 17-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 21-37: Peptide Fragment Reference

Comprehensive reference for amylin 21-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 25-37: Peptide Fragment Reference

Comprehensive reference for amylin 25-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin 8 37: Neuropeptide in Neuroscience Reference

amylin-8-37 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...

Neuropeptides intermediate

Amylin 8-21: Peptide Fragment Reference

Comprehensive reference for amylin 8-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Amylin Hormone: Endogenous Peptide Hormone Reference

Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Amylin Peptide Hormone: Endogenous Peptide Hormone Reference

Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Amylin Protein Hormone: Endogenous Peptide Hormone Reference

Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Amylin: Endogenous Peptide Hormone Reference

37-amino acid peptide hormone co-secreted with insulin from pancreatic beta cells, regulating gastric emptying and glucagon.

Pancreatic Peptides intermediate

Amyloid Beta 42: Oligopeptide Research Reference

amyloid beta 42 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Diagnostic Peptides intermediate

Amyloid-beta → Neprilysin (Substrate)

Comprehensive reference for Amyloid-beta → Neprilysin (Substrate), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Amyloid-beta 40: Oligopeptide Research Reference

40-aa peptide from APP. Less aggregation-prone than Aβ42. Aβ42/40 ratio is better. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

Amyloid-beta 42 (Aβ42): Oligopeptide Research Reference

Amyloid-beta 42 (Aβ42), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarker Peptides intermediate

Amyloid-beta 42: Oligopeptide Research Reference

42-aa peptide from APP. Forms toxic plaques in Alzheimer's disease. AD biomarker. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Amyloid-beta 42/40 Ratio: Oligopeptide Research Reference

Ratio of Aβ42 to Aβ40. Decreased in amyloid pathology. Better than Aβ42 alone. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

Amyloid-beta Aggregation (Self-association)

Comprehensive reference for Amyloid-beta Aggregation (Self-association), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Amyloid-beta oligomer: Oligopeptide Research Reference

Comprehensive reference for amyloid-beta oligomer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Amyotrophic Lateral Sclerosis (ALS)

Comprehensive reference for Amyotrophic Lateral Sclerosis (ALS), a peptide compound with applications in research and therapeutics.

Neurological intermediate

Anabaena flos-aquae: Oligopeptide Research Reference

Irreversible acetylcholinesterase inhibitor. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Protist Peptides intermediate

Anakinra: Oligopeptide Research Reference

anakinra in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Drugs intermediate

Analgesic / Opioid Agonist: Comprehensive Peptide Reference

Analgesic / Opioid Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...

Peptide Analogs intermediate

Analysis Technologies: Oligopeptide Research Reference

Techniques for peptide characterization. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Technologies intermediate

Analysis Technology Comparison

Comparison of different analytical technologies for peptide characterization. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

Analytical Ultracentrifugation for Peptides

Understand analytical ultracentrifugation for determining peptide molecular weight and oligomeric state in solution. Covers molecular mechanisms, biological ...

Peptide Analysis advanced

analytical-ultracentrifugation for Peptides

Application of analytical-ultracentrifugation technique for peptide characterization, structure determination, or formulation.

Structural Biology Techniques advanced

Anaphylaxis: Oligopeptide Research Reference

Severe allergic reaction to peptide drugs. Can be life-threatening. Requires immediate treatment with epinephrine. Covers molecular mechanisms, biological ac...

Peptide Therapeutics intermediate

Androctonin: Antimicrobial Peptide Reference

Scorpion venom defensin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its...

Antimicrobial Peptides intermediate

Androstenedione Hormone: Endogenous Peptide Hormone Refer...

Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...

Peptide Hormones intermediate

Androstenedione Peptide Hormone

Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...

Peptide Hormones intermediate

Androstenedione Protein Hormone

Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...

Peptide Hormones intermediate

Angiotensin 1 7: Oligopeptide Research Reference

angiotensin 1 7 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Cardiovascular Peptides intermediate

Angiotensin 1-7: Peptide Fragment Reference

Heptapeptide counter-regulatory hormone of the RAAS that opposes angiotensin II effects through Mas receptor activation.

Cardiovascular Peptides advanced

Angiotensin Family Peptides: Comprehensive Peptide Reference

Learn about angiotensin I-IV peptides in the renin-angiotensin system and blood pressure regulation. This peptide or oligopeptide is studied for its biologic...

Peptide Families intermediate

Angiotensin I → ACE (Substrate)

Comprehensive reference for Angiotensin I → ACE (Substrate), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Angiotensin I Hormone: Endogenous Peptide Hormone Reference

Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...

Peptide Hormones intermediate

Angiotensin I Peptide Hormone: Comprehensive Peptide Refe...

Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...

Peptide Hormones intermediate

Angiotensin I Protein Hormone: Comprehensive Peptide Refe...

Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...

Peptide Hormones intermediate

Angiotensin I: Oligopeptide Research Reference

Angiotensin I is a decapeptide generated from angiotensinogen by renin, serving as the obligate substrate for angiotensin-converting enzyme in the renin-angi...

Vasoactive Peptides intermediate

Angiotensin I: Oligopeptide Research Reference

angiotensin I in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Cardiovascular Peptides intermediate

Angiotensin II Hormone: Endogenous Peptide Hormone Reference

Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Angiotensin II Peptide Hormone

Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Angiotensin II Protein Hormone

Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Angiotensin II: Endogenous Peptide Hormone Reference

Octapeptide vasoconstrictor hormone of the renin-angiotensin system that regulates blood pressure and fluid balance. Covers molecular mechanisms, biological ...

Cardiovascular Peptides intermediate

Angiotensin II: Oligopeptide Research Reference

angiotensin II in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Cardiovascular Peptides intermediate

Angiotensin III: Oligopeptide Research Reference

angiotensin III in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Cardiovascular Peptides intermediate

Angiotensin IV: Oligopeptide Research Reference

angiotensin IV in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Cardiovascular Peptides intermediate

Anidulafungin: Oligopeptide Research Reference

Echinocandin with long half-life for candidiasis without hepatic or renal dose adjustment. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

Anidulafungin: Oligopeptide Research Reference

anidulafungin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Drugs intermediate

Animal Nutrition: Oligopeptide Research Reference

Use of bioactive peptides in animal feed. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Peptide Therapeutics intermediate

Annexin A1: Oligopeptide Research Reference

annexin A1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Anti-inflammatory Peptides intermediate

ANP 11-28: Peptide Fragment Reference

Comprehensive reference for ANP 11-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 13-28: Peptide Fragment Reference

Comprehensive reference for ANP 13-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 15-28: Peptide Fragment Reference

Comprehensive reference for ANP 15-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 17-28: Peptide Fragment Reference

Comprehensive reference for ANP 17-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 19-28: Peptide Fragment Reference

Comprehensive reference for ANP 19-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 21-28: Peptide Fragment Reference

Comprehensive reference for ANP 21-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 23-28: Peptide Fragment Reference

Comprehensive reference for ANP 23-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 25-28: Peptide Fragment Reference

Comprehensive reference for ANP 25-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 27-28: Peptide Fragment Reference

Comprehensive reference for ANP 27-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 3-28: Peptide Fragment Reference

Comprehensive reference for ANP 3-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 5-28: Peptide Fragment Reference

Comprehensive reference for ANP 5-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 7-28: Peptide Fragment Reference

Comprehensive reference for ANP 7-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP 9-28: Peptide Fragment Reference

Comprehensive reference for ANP 9-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

ANP Fragment: Oligopeptide Research Reference

ANP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Cardiovascular Peptides intermediate

ANP Hormone: Endogenous Peptide Hormone Reference

ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

ANP Peptide Hormone: Endogenous Peptide Hormone Reference

ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

ANP Protein Hormone: Endogenous Peptide Hormone Reference

ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

ANP(1 28): Endogenous Peptide Hormone Reference

ANP(1-28) is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.

Peptide Hormones intermediate

ANP(99 126): Endogenous Peptide Hormone Reference

ANP(99-126) is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.

Peptide Hormones intermediate

Anserine: Oligopeptide Research Reference

β-alanyl-Nτ-methyl-L-histidine. Dipeptide in muscle tissue. pH buffer, antioxidant. Found in poultry, marine fish. Covers molecular mechanisms, biological ac...

Peptide Therapeutics intermediate

Antamanide: Oligopeptide Research Reference

Antamanide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Anti-Aging: Oligopeptide Research Reference

Peptide-based approaches to skin aging. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

Anti-Drug Antibodies (ADA): Comprehensive Peptide Reference

Antibodies generated against therapeutic peptides. Can reduce efficacy and cause allergic reactions. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Anti-Infective / Cyclic Peptide Antibiotic

Anti-Infective / Cyclic Peptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics.

Therapeutic Peptides Expanded intermediate

Anti-Infective / Lipoglycopeptide Antibiotic

Anti-Infective / Lipoglycopeptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics.

Therapeutic Peptides Expanded intermediate

Anti-Infective / Lipopeptide Antibiotic

Anti-Infective / Lipopeptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...

Therapeutic Peptides Expanded intermediate

Anti-infective: Oligopeptide Research Reference

Clinical trials for infectious diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Therapeutics intermediate

Antibiotic Interactions: Oligopeptide Research Reference

Drug interactions between peptide antibiotics and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Therapeutics intermediate

Antibody Conjugation Synthesis

A peptide synthesis method using Antibody Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Antibody-drug conjugate: Oligopeptide Research Reference

Comprehensive reference for antibody-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Anticoagulant Interactions: Comprehensive Peptide Reference

Drug interactions between anticoagulant peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Antidiabetic Interactions: Comprehensive Peptide Reference

Drug interactions between peptide diabetes drugs and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Antifungal Peptide Drugs: Oligopeptide Research Reference

Peptide-based antifungal agents including lipopeptides and cyclic peptides for invasive fungal infections. This peptide or oligopeptide is studied for its bi...

Antifungal Peptides intermediate

Antimicrobial Peptide Drugs: Comprehensive Peptide Reference

Therapeutic antimicrobial peptides for drug-resistant infections including cationic and lipopeptide classes. This peptide or oligopeptide is studied for its ...

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-1

Comprehensive reference for antimicrobial peptide library AMP-library-1, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-10

Comprehensive reference for antimicrobial peptide library AMP-library-10, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-11

Comprehensive reference for antimicrobial peptide library AMP-library-11, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-12

Comprehensive reference for antimicrobial peptide library AMP-library-12, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-13

Comprehensive reference for antimicrobial peptide library AMP-library-13, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-14

Comprehensive reference for antimicrobial peptide library AMP-library-14, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-15

Comprehensive reference for antimicrobial peptide library AMP-library-15, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-16

Comprehensive reference for antimicrobial peptide library AMP-library-16, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-17

Comprehensive reference for antimicrobial peptide library AMP-library-17, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-18

Comprehensive reference for antimicrobial peptide library AMP-library-18, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-19

Comprehensive reference for antimicrobial peptide library AMP-library-19, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-2

Comprehensive reference for antimicrobial peptide library AMP-library-2, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-20

Comprehensive reference for antimicrobial peptide library AMP-library-20, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-21

Comprehensive reference for antimicrobial peptide library AMP-library-21, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-22

Comprehensive reference for antimicrobial peptide library AMP-library-22, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-23

Comprehensive reference for antimicrobial peptide library AMP-library-23, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-24

Comprehensive reference for antimicrobial peptide library AMP-library-24, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-25

Comprehensive reference for antimicrobial peptide library AMP-library-25, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-26

Comprehensive reference for antimicrobial peptide library AMP-library-26, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-27

Comprehensive reference for antimicrobial peptide library AMP-library-27, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-28

Comprehensive reference for antimicrobial peptide library AMP-library-28, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-29

Comprehensive reference for antimicrobial peptide library AMP-library-29, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-3

Comprehensive reference for antimicrobial peptide library AMP-library-3, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-30

Comprehensive reference for antimicrobial peptide library AMP-library-30, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-31

Comprehensive reference for antimicrobial peptide library AMP-library-31, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-32

Comprehensive reference for antimicrobial peptide library AMP-library-32, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-33

Comprehensive reference for antimicrobial peptide library AMP-library-33, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-34

Comprehensive reference for antimicrobial peptide library AMP-library-34, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-35

Comprehensive reference for antimicrobial peptide library AMP-library-35, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-36

Comprehensive reference for antimicrobial peptide library AMP-library-36, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-37

Comprehensive reference for antimicrobial peptide library AMP-library-37, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-38

Comprehensive reference for antimicrobial peptide library AMP-library-38, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-39

Comprehensive reference for antimicrobial peptide library AMP-library-39, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-4

Comprehensive reference for antimicrobial peptide library AMP-library-4, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-40

Comprehensive reference for antimicrobial peptide library AMP-library-40, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-41

Comprehensive reference for antimicrobial peptide library AMP-library-41, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-42

Comprehensive reference for antimicrobial peptide library AMP-library-42, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-43

Comprehensive reference for antimicrobial peptide library AMP-library-43, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-44

Comprehensive reference for antimicrobial peptide library AMP-library-44, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-45

Comprehensive reference for antimicrobial peptide library AMP-library-45, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-46

Comprehensive reference for antimicrobial peptide library AMP-library-46, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-47

Comprehensive reference for antimicrobial peptide library AMP-library-47, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-48

Comprehensive reference for antimicrobial peptide library AMP-library-48, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-49

Comprehensive reference for antimicrobial peptide library AMP-library-49, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-5

Comprehensive reference for antimicrobial peptide library AMP-library-5, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-50

Comprehensive reference for antimicrobial peptide library AMP-library-50, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-51

Comprehensive reference for antimicrobial peptide library AMP-library-51, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-52

Comprehensive reference for antimicrobial peptide library AMP-library-52, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-53

Comprehensive reference for antimicrobial peptide library AMP-library-53, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-54

Comprehensive reference for antimicrobial peptide library AMP-library-54, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-55

Comprehensive reference for antimicrobial peptide library AMP-library-55, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-56

Comprehensive reference for antimicrobial peptide library AMP-library-56, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-57

Comprehensive reference for antimicrobial peptide library AMP-library-57, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-58

Comprehensive reference for antimicrobial peptide library AMP-library-58, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-59

Comprehensive reference for antimicrobial peptide library AMP-library-59, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-6

Comprehensive reference for antimicrobial peptide library AMP-library-6, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-60

Comprehensive reference for antimicrobial peptide library AMP-library-60, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-7

Comprehensive reference for antimicrobial peptide library AMP-library-7, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-8

Comprehensive reference for antimicrobial peptide library AMP-library-8, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Library AMP-library-9

Comprehensive reference for antimicrobial peptide library AMP-library-9, covering molecular structure, pharmacological properties, receptor interactions,

Antimicrobial Peptides intermediate

Antimicrobial Peptide Market: Comprehensive Peptide Refer...

Market analysis for antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Peptide Therapeutics intermediate

Antimicrobial Peptide Overdose

Excessive dosing of antimicrobial peptides. Can cause toxicity and resistance. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

Antimicrobial Peptides: Oligopeptide Research Reference

Antimicrobial (Gram-negative focus). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Insect Peptides intermediate

Antimicrobial Synthetic: Oligopeptide Research Reference

Engineered antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Synthetic Peptides intermediate

Antioxidant Peptides (General)

Comprehensive reference for Antioxidant Peptides (General), a peptide compound with applications in research and therapeutics.

Food Peptides intermediate

Antisense oligonucleotide: Comprehensive Peptide Reference

Comprehensive reference for antisense oligonucleotide, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Antithymocyte Globulin: Oligopeptide Research Reference

Polyclonal antibody preparation against human T cells used for transplant induction and acute rejection treatment. Covers molecular mechanisms, biological ac...

Transplant Peptides advanced

Antiviral Peptides: Therapeutics Against Emerging Viruses

Comprehensive overview of peptide-based antivirals targeting viral entry, replication, and assembly. This peptide or oligopeptide is studied for its biologic...

Antiviral Peptides advanced

Anxiety and Peptides: Oligopeptide Research Reference

Learn about anxiolytic peptide therapeutics targeting neuropeptide Y, CRF, and GABAergic peptide systems. This peptide or oligopeptide is studied for its bio...

Peptide Therapeutics advanced

Anxiety Disorders: Oligopeptide Research Reference

Group of disorders characterized by excessive fear and anxiety. Includes GAD, social anxiety, panic disorder, specific phobias. Treatments: SSRIs, SNRIs, ben...

Peptide Therapeutics intermediate

Anxiety Peptides: Oligopeptide Research Reference

Peptides associated with Anxiety including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Aortic Aneurysm: Oligopeptide Research Reference

Aortic Aneurysm, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Cardiovascular intermediate

Apamin (Apis): Oligopeptide Research Reference

Apamin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Apamin: Oligopeptide Research Reference

Bee venom neurotoxic peptide that selectively blocks small-conductance calcium-activated potassium channels. This peptide or oligopeptide is studied for its ...

Neurotoxic Peptides intermediate

Apamin: Peptide Toxin in Pharmacology Reference

Apamin is an 18-amino acid bee venom neurotoxin that selectively blocks small-conductance calcium-activated potassium channels (SK channels), used as a neuro...

Toxin Peptides advanced

APC Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting APC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

APD3 (Antimicrobial Peptide Database)

Comprehensive database of antimicrobial peptides with sequences and activities. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

APD3: Oligopeptide Research Reference

Antimicrobial Peptide Database. Comprehensive database of antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Apelin Hormone: Endogenous Peptide Hormone Reference

Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Apelin Peptide Hormone: Endogenous Peptide Hormone Reference

Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Apelin Protein Hormone: Endogenous Peptide Hormone Reference

Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Apelin: Oligopeptide Research Reference

Apelin is an adipokine peptide that activates the APJ receptor to regulate cardiovascular function, fluid homeostasis, and energy metabolism.

Metabolic intermediate

Apidaecin: Antimicrobial Peptide Reference

Proline-rich AMP from honeybee hemolymph inhibiting bacterial protein synthesis. This antimicrobial peptide demonstrates activity against pathogens and is st...

Antimicrobial Peptides intermediate

Appetite-Regulating Peptides: Comprehensive Peptide Refer...

Network of neuropeptides controlling hunger, satiety, and energy balance. This neuropeptide is involved in neurological signaling and is studied for its role...

Neuropeptides intermediate

Apple Peptide: Oligopeptide Research Reference

A bioactive peptide derived from apple with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Applied Photophysics Chirascan

Circular dichroism spectrometer for protein secondary structure analysis. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide Therapeutics intermediate

Approved Therapeutics: Oligopeptide Research Reference

Approved Therapeutics, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bacterial Peptides intermediate

Aprotinin: Oligopeptide Research Reference

aprotinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Aptamer Conjugation Synthesis: Comprehensive Peptide Refe...

A peptide synthesis method using Aptamer Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...

Peptide Synthesis Methods advanced

Aptamer Drug System 1: Oligopeptide Research Reference

A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Aptamer Drug System 2: Oligopeptide Research Reference

A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Aptamer Drug System 3: Oligopeptide Research Reference

A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Aptamer System 1: Oligopeptide Research Reference

A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Aptamer System 2: Oligopeptide Research Reference

A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Aptamer System 3: Oligopeptide Research Reference

A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Aptamer-drug conjugate: Oligopeptide Research Reference

Comprehensive reference for aptamer-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Aptamer: Oligopeptide Research Reference

Comprehensive reference for aptamer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Aquaculture: Oligopeptide Research Reference

Use of antimicrobial peptides in aquaculture. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

Argatroban: Oligopeptide Research Reference

Synthetic direct thrombin inhibitor for heparin-induced thrombocytopenia with active site binding. This peptide or oligopeptide is studied for its biological...

Peptide Drugs intermediate

Arginine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Arginine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...

Amino Acid Metabolism intermediate

Arginine Modification: Post-Translational Modification Re...

Post-translational modifications of Arginine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...

Amino Acid Modifications intermediate

Arginine Peptide: Oligopeptide Research Reference

Arginine (R) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...

Amino Acid Peptides beginner

Argipressin: Oligopeptide Research Reference

Argipressin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Argireline: Oligopeptide Research Reference

Acetyl hexapeptide-3. Inhibits SNARE complex. Topical anti-wrinkle peptide (mild Botox-like effect). This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Arrhythmia Peptides: Oligopeptide Research Reference

Peptides associated with Arrhythmia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Arrhythmia: Oligopeptide Research Reference

Arrhythmia, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Cardiovascular intermediate

Artemin Hormone: Endogenous Peptide Hormone Reference

Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Artemin Peptide Hormone: Endogenous Peptide Hormone Refer...

Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Artemin Protein Hormone: Endogenous Peptide Hormone Refer...

Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Arthritis and Peptides: Oligopeptide Research Reference

Discover peptide-based therapies for rheumatoid and osteoarthritis including anti-inflammatory and joint-protective peptides.

Peptide Therapeutics intermediate

ASO System 1: Oligopeptide Research Reference

A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

ASO System 2: Oligopeptide Research Reference

A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

ASO System 3: Oligopeptide Research Reference

A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

Asp49 PLA2: Peptide Toxin in Pharmacology Reference

Asp49-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

Asparagine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Asparagine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...

Amino Acid Metabolism intermediate

Asparagine Modification: Post-Translational Modification ...

Post-translational modifications of Asparagine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...

Amino Acid Modifications intermediate

Asparagine Peptide: Oligopeptide Research Reference

Asparagine (N) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...

Amino Acid Peptides beginner

Asparagus Peptide: Oligopeptide Research Reference

A bioactive peptide derived from asparagus with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

Aspart Pump Cartridge: Oligopeptide Research Reference

Preservative-free insulin aspart for pump cartridges with 48-hour reservoir dwell time stability. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs beginner

Aspartate Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Aspartate including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...

Amino Acid Metabolism intermediate

Aspartate Modification: Post-Translational Modification R...

Post-translational modifications of Aspartate including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...

Amino Acid Modifications intermediate

Aspartate Peptide: Oligopeptide Research Reference

Aspartate (D) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...

Amino Acid Peptides beginner

Assignee: Oligopeptide Research Reference

Key Products. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Peptide Patents intermediate

association-constant Resource: Comprehensive Peptide Refe...

The association-constant database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Astaxanthin Peptide: Oligopeptide Research Reference

astaxanthin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Antioxidant Peptides intermediate

Astaxanthin-Peptide Conjugates

Comprehensive reference for Astaxanthin-Peptide Conjugates, a peptide compound with applications in research and therapeutics.

Marine Peptides intermediate

Asthma Peptides: Oligopeptide Research Reference

Peptides associated with Asthma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

AstraZeneca: Oligopeptide Research Reference

Goserelin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...

Peptide Patents intermediate

Atezolizumab: Oligopeptide Research Reference

atezolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Atherosclerosis Peptides: Oligopeptide Research Reference

Peptides associated with Atherosclerosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...

Disease-Associated Peptides intermediate

Atherosclerosis: Oligopeptide Research Reference

Arterial wall inflammation, lipid accumulation, plaque formation. Treatments: statins, antiplatelets, PCSK9 inhibitors. Covers molecular mechanisms, biologic...

Peptide Therapeutics intermediate

Atogepant: Oligopeptide Research Reference

Oral CGRP receptor antagonist for episodic migraine prevention with daily dosing. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Drugs beginner

Atomic Force Microscopy: Oligopeptide Research Reference

AFM for imaging peptide and protein structures at nanometer resolution. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Atosiban: Oligopeptide Research Reference

Oxytocin receptor antagonist for preterm labor with D-Tyr providing competitive myometrial relaxation. This peptide or oligopeptide is studied for its biolog...

Peptide Drugs intermediate

Atrial Natriuretic Peptide: Comprehensive Peptide Reference

A 28-amino acid cardiac peptide that promotes natriuresis, diuresis, and vasodilation to regulate blood volume and pressure.

Cardiovascular intermediate

ATSP-7041 - First-in-Human (NCT02264614)

First-in-human trial of ATSP-7041, a stapled peptide MDM2 antagonist. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

ATSP-7041 - MDM2/MDMX (NCT04022877)

Phase II trial of ATSP-7041 for MDM2/MDMX-driven cancers. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...

Peptide Therapeutics intermediate

ATSP-7041: Oligopeptide Research Reference

ATSP-7041, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Attacin (Hyalophora): Oligopeptide Research Reference

Attacin (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Attacin E: Antimicrobial Peptide Reference

AMP from Hyalophora cecropia with antibacterial activity targeting outer membrane. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides intermediate

Attention for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using Attention. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

ATX-II: Peptide Toxin in Pharmacology Reference

ATX-II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

ATX-MS-1467: Oligopeptide Research Reference

ATX-MS-1467, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

AUC Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using AUC. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

AUC-PR Resource: Oligopeptide Research Reference

The AUC-PR database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...

Databases & Resources intermediate

AUC-ROC Resource: Oligopeptide Research Reference

The AUC-ROC database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...

Databases & Resources intermediate

Augmentin: Antimicrobial Peptide Reference

augmentin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biologi...

Antimicrobial Peptides intermediate

Autism Peptides: Oligopeptide Research Reference

Peptides associated with Autism including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Autoencoder for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using Autoencoder. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

Autoimmune / Multiple Sclerosis

Autoimmune / Multiple Sclerosis is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Peptide Vaccines intermediate

Autoimmune Diseases and Peptides

Understand peptide immunotherapies for autoimmune conditions including tolerance induction and cytokine modulation. Covers molecular mechanisms, biological a...

Peptide Therapeutics advanced

Autoimmune Diseases: Oligopeptide Research Reference

Immune system attacks self-tissues. >80 known autoimmune diseases. Examples: RA, lupus, MS, type 1 diabetes, IBD, psoriasis. Treatments: immunosuppressants, ...

Peptide Therapeutics intermediate

Autoimmune Peptides: Oligopeptide Research Reference

Peptides associated with Autoimmune including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Automated SPPS: Oligopeptide Research Reference

mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Avalglucosidase Alfa: Oligopeptide Research Reference

Avalglucosidase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Avelumab: Oligopeptide Research Reference

avelumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Drugs intermediate

Avian Beta-Defensin 1 (AvBD1): Comprehensive Peptide Refe...

Comprehensive reference for Avian Beta-Defensin 1 (AvBD1), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Avian Beta-Defensin 1 (Chicken)

Comprehensive reference for Avian Beta-Defensin 1 (Chicken), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Avian Beta-Defensin 2 (Chicken)

Comprehensive reference for Avian Beta-Defensin 2 (Chicken), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Avian Beta-Defensin 3 (AvBD3): Comprehensive Peptide Refe...

Comprehensive reference for Avian Beta-Defensin 3 (AvBD3), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Avian Beta-Defensin 3 (Chicken)

Comprehensive reference for Avian Beta-Defensin 3 (Chicken), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Avian Beta-Defensin 4 (Chicken)

Comprehensive reference for Avian Beta-Defensin 4 (Chicken), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Avian Beta-Defensin 5 (AvBD5): Comprehensive Peptide Refe...

Comprehensive reference for Avian Beta-Defensin 5 (AvBD5), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Avian Beta-Defensin 5 (Chicken)

Comprehensive reference for Avian Beta-Defensin 5 (Chicken), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Avian Serum Peptides: Oligopeptide Research Reference

Avian Serum Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Avibactam: Oligopeptide Research Reference

Diazabicyclooctane beta-lactamase inhibitor that restores activity of cephalosporins against resistant gram-negative bacteria.

Beta-Lactamase Inhibitors advanced

Avidin Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using Avidin. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

Avocado Peptide: Oligopeptide Research Reference

A bioactive peptide derived from avocado with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Azaspiracid: Oligopeptide Research Reference

Azaspiracid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Azide Alkyne Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Azide Alkyne for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

Azido Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using Azido. This analytical technique provides valuable insights into peptide structure, puri...

Purification Methods advanced

B Anthracis Peptide: Oligopeptide Research Reference

A peptide associated with B Anthracis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

B Burgdorferi Peptide: Oligopeptide Research Reference

A peptide associated with B Burgdorferi for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

B Cereus Peptide: Oligopeptide Research Reference

A peptide associated with B Cereus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

B Henselae Peptide: Oligopeptide Research Reference

A peptide associated with B Henselae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...

Microbial Peptides intermediate

B Pertussis Peptide: Oligopeptide Research Reference

A peptide associated with B Pertussis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

B-cerulein: Antimicrobial Peptide Reference

B-cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Bac5: Oligopeptide Research Reference

Bac5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Bac7: Oligopeptide Research Reference

Bac7, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Bacitracin: Antimicrobial Peptide Reference

bacitracin is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Backbone Mod System 1: Oligopeptide Research Reference

A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Backbone Mod System 2: Oligopeptide Research Reference

A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Backbone Mod System 3: Oligopeptide Research Reference

A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Backbone: Post-Translational Modification Reference

Hours–days. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...

Peptide Modifications intermediate

Bactenecin: Oligopeptide Research Reference

Bactenecin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Bacterial Toxins: Oligopeptide Research Reference

Neuromuscular / cytotoxic. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Bacterial Peptides intermediate

Bacteriocins: Oligopeptide Research Reference

Antimicrobial (Gram-positive). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Bacterial Peptides intermediate

Bacterium: Peptide Toxin in Pharmacology Reference

0.000001 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in res...

Toxin Peptides intermediate

Balenine: Oligopeptide Research Reference

balenine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Bam 22: Neuropeptide in Neuroscience Reference

bam-22 is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation. Covers molecular mechanisms, biologica...

Neuropeptides intermediate

Banana Peptide: Oligopeptide Research Reference

A bioactive peptide derived from banana with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Barley Peptide: Oligopeptide Research Reference

A bioactive peptide derived from barley with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Basal Insulin Analogue Design Principles

Rational design principles for engineering ultra-long-acting basal insulin analogues with flat pharmacokinetic profiles.

Insulin Family advanced

Basal-Bolus Insulin Regimens: Comprehensive Peptide Refer...

Intensive insulin therapy combining basal insulin analogue with rapid-acting prandial insulin doses. This peptide or oligopeptide is studied for its biologic...

Insulin Family intermediate

Base Labile Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Base Labile. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

Basic PLA2: Peptide Toxin in Pharmacology Reference

basic-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

Basiliximab: Oligopeptide Research Reference

Chimeric anti-CD25 monoclonal antibody that prevents acute rejection in kidney transplant by blocking IL-2 receptor activation.

Transplant Peptides intermediate

Batch Release Testing: Oligopeptide Research Reference

Understand batch release testing requirements for peptide drugs including identity, purity, potency, and sterility assays.

Regulatory intermediate

Batrachotoxin: Peptide Toxin in Pharmacology Reference

Batrachotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

BCL 2 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting BCL 2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

BCL XL Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting BCL XL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide-Drug Conjugates advanced

Bdellin: Oligopeptide Research Reference

Bdellin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

BDNF Hormone: Endogenous Peptide Hormone Reference

BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

BDNF Mimetic: Oligopeptide Research Reference

BDNF mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Neurological Peptides intermediate

BDNF Peptide Hormone: Endogenous Peptide Hormone Reference

BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

BDNF Protein Hormone: Endogenous Peptide Hormone Reference

BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

BDS-I (Blood Depressor Substance I)

Comprehensive reference for BDS-I (Blood Depressor Substance I), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

BDS-I: Peptide Toxin in Pharmacology Reference

BDS-I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Bean Peptide: Oligopeptide Research Reference

A bioactive peptide derived from bean with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Beauvericin: Oligopeptide Research Reference

Beauvericin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Bee Venom Adolapin: Peptide Toxin in Pharmacology Reference

Anti-inflammatory peptide from bee venom inhibiting cyclooxygenase activity. This peptide toxin is derived from venom and studied for its pharmacological act...

Venom Peptides intermediate

Bee Venom Anti-Inflammatory: Comprehensive Peptide Reference

Therapeutic anti-inflammatory applications of bee venom components. This peptide toxin is derived from venom and studied for its pharmacological activity, me...

Venom Peptides intermediate

Bee Venom Apamin: Peptide Toxin in Pharmacology Reference

Selective SK potassium channel blocker from honeybee venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism ...

Venom Peptides intermediate

Bee Venom Apitherapy: Peptide Toxin in Pharmacology Refer...

Clinical applications of bee venom in traditional and integrative medicine. This peptide toxin is derived from venom and studied for its pharmacological acti...

Venom Peptides intermediate

Bee Venom Mastoparan: Peptide Toxin in Pharmacology Refer...

Mast cell degranulating peptide from bee venom causing histamine release. This peptide toxin is derived from venom and studied for its pharmacological activi...

Venom Peptides intermediate

Bee Venom Melittin: Peptide Toxin in Pharmacology Reference

Pharmacological applications of melittin beyond bee sting toxicity. This peptide toxin is derived from venom and studied for its pharmacological activity, me...

Venom Peptides intermediate

Bee Venom Neuroprotective: Comprehensive Peptide Reference

Neuroprotective properties of bee venom components in neurodegenerative disease. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

Bee Venom Phospholipase A2: Comprehensive Peptide Reference

Major allergenic enzyme component of honeybee venom with inflammatory effects. This peptide toxin is derived from venom and studied for its pharmacological a...

Venom Peptides intermediate

Bee: Peptide Toxin in Pharmacology Reference

4.0 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in research...

Toxin Peptides intermediate

Bee/Wasp Venoms: Peptide Toxin in Pharmacology Reference

Membranes, K+, G-proteins, nAChR. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential a...

Venom Peptides intermediate

Bepranemab: Oligopeptide Research Reference

Bepranemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

BERT for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using BERT. This analytical technique provides valuable insights into peptide structure, purity, and characteriz...

Computational Methods advanced

Beta Bungarotoxin: Peptide Toxin in Pharmacology Reference

beta-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmac...

Venom Peptides intermediate

Beta Defensin 1: Antimicrobial Peptide Reference

beta-defensin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Beta Defensin 2: Antimicrobial Peptide Reference

beta-defensin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Beta Defensin 3: Antimicrobial Peptide Reference

beta-defensin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Beta Defensin 4: Antimicrobial Peptide Reference

beta-defensin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Beta-Amino Acids: Oligopeptide Research Reference

Amino acids with β-amino group. Enhance proteolytic resistance in peptides. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Therapeutics intermediate

Beta-Defensin Dimerization: Comprehensive Peptide Reference

Homodimer formation enhancing antimicrobial potency through avidity effects. This antimicrobial peptide demonstrates activity against pathogens and is studie...

Antimicrobial Peptides advanced

Beta-Endorphin Central: Neuropeptide in Neuroscience Refe...

Central effects of beta-endorphin on pain, reward, and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides intermediate

Beta-Endorphin: Neuropeptide in Neuroscience Reference

A 31-amino acid endogenous opioid peptide derived from proopiomelanocortin (POMC) that produces potent analgesia and euphoria through mu-opioid receptor acti...

Neuropeptides intermediate

Beta-hCG: Oligopeptide Research Reference

Beta subunit of hCG. Trophoblast hormone. Pregnancy and GTD biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Therapeutics intermediate

Beta-Neo-Endorphin: Neuropeptide in Neuroscience Reference

Prodynorphin-derived opioid with kappa-selectivity in hypothalamus. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Betatrophin Hormone: Endogenous Peptide Hormone Reference

Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Betatrophin Peptide Hormone: Comprehensive Peptide Reference

Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Betatrophin Protein Hormone: Comprehensive Peptide Reference

Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Betatrophin: Structure, Function, and Significance

Betatrophin (FGF21-like) is a hormone that promotes beta-cell proliferation and may play a role in type 2 diabetes. Covers molecular mechanisms, biological a...

Peptide Hormones intermediate

Big Dynorphin: Neuropeptide in Neuroscience Reference

Precursor form containing both dynorphin A and B sequences. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fun...

Neuropeptides intermediate

Big Endothelin: Oligopeptide Research Reference

big endothelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Cardiovascular Peptides intermediate

Bimatoprost: Oligopeptide Research Reference

Bimatoprost, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

binding-affinity Resource: Comprehensive Peptide Reference

The binding-affinity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Binding: Oligopeptide Research Reference

Non-covalent molecular recognition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Peptide Interactions intermediate

Binds basigin (CD147) for merozoite invasion

Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Protist Peptides intermediate

Binds cell wall mannan, disrupts membrane

Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

Binds cell wall receptor, disrupts membrane

Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

Binds ergosterol, forms membrane pores

Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Yeast Peptides intermediate

Binds Nav1.x, shifts activation potential

Dinoflagellate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Protist Peptides intermediate

Binds Ste2p GPCR receptor, activates MAPK cascade

Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

Binds to membrane receptor, forms channels

Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

Binds to PKA regulatory domain

Yeast signaling peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

Bioactive Egg White Peptides: Comprehensive Peptide Refer...

Comprehensive reference for Bioactive Egg White Peptides, a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Bioanalytical Method Validation

Understand bioanalytical method validation requirements for quantifying peptides in pharmacokinetic and toxicology studies.

Regulatory advanced

BioBERT for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using BioBERT. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

Biocatalysis: Oligopeptide Research Reference

Enzymatic methods for peptide synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Therapeutics intermediate

Biocatalytic Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Biocatalytic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

Bioconjugate Chemistry: Oligopeptide Research Reference

Journal focused on bioconjugation chemistry and its applications. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Bioconjugation Synthesis: Analytical Technique in Peptide...

A peptide synthesis method using Bioconjugation for producing peptides with specific properties. This analytical technique provides valuable insights into pe...

Peptide Synthesis Methods advanced

Biomanufacturing: Oligopeptide Research Reference

Large-scale production of peptides using biotechnology methods. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Peptide Therapeutics intermediate

biomarker-response Resource: Comprehensive Peptide Reference

The biomarker-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Biomaterials: Oligopeptide Research Reference

Peptide-based biomaterials for tissue engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Therapeutics intermediate

Biopeptide EL: Oligopeptide Research Reference

Acetyl tetrapeptide-3. Stimulates extracellular matrix. Anti-aging hair care. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

Biosensor Analysis for Peptides

Explore label-free biosensor platforms for real-time monitoring of peptide binding and enzymatic activity. This peptide or oligopeptide is studied for its bi...

Peptide Analysis intermediate

Biosensors: Oligopeptide Research Reference

Peptide-based biosensors for detecting analytes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

Biosimilar Peptides: Regulatory and Development Pathways

Navigate the complex regulatory landscape for biosimilar peptide drugs, from analytical similarity to clinical confirmation.

Biosimilars advanced

Biosimilar Premixed 70/30: Comprehensive Peptide Reference

Biosimilar intermediate premixed insulin combining 70% NPH and 30% regular human insulin. This peptide or oligopeptide is studied for its biological activity...

Peptide Drugs beginner

Biotage Syro: Oligopeptide Research Reference

Automated peptide synthesizer for SPPS. High-throughput parallel synthesis. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Therapeutics intermediate

Biotin Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using Biotin. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

Biotin-Streptavidin: Oligopeptide Research Reference

Biotin-Streptavidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Biotinylation Synthesis: Analytical Technique in Peptide ...

A peptide synthesis method using Biotinylation for producing peptides with specific properties. This analytical technique provides valuable insights into pep...

Peptide Synthesis Methods advanced

Bipolar Peptides: Oligopeptide Research Reference

Peptides associated with Bipolar including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Bispecific antibody: Oligopeptide Research Reference

Comprehensive reference for bispecific antibody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Bispecific System 1: Oligopeptide Research Reference

A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Bispecific System 2: Oligopeptide Research Reference

A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Bispecific System 3: Oligopeptide Research Reference

A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Bivalirudin: Oligopeptide Research Reference

Direct thrombin inhibitor bivalent hirudin analog for PCI and heparin-induced thrombocytopenia. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs intermediate

Bivalirudin: Oligopeptide Research Reference

Synthetic 20-amino acid direct thrombin inhibitor derived from hirudin, used as an anticoagulant during percutaneous coronary intervention.

Cardiovascular Peptides advanced

Bivalirudin: Oligopeptide Research Reference

bivalirudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Blackberry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from blackberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Plant-Derived Peptides intermediate

Bladder Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Bladder Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...

Disease-Associated Peptides intermediate

Bleomycin Glycopeptide Antibiotic

Glycopeptide antitumor antibiotic generating free radicals causing DNA strand breaks, used for Hodgkin lymphoma and germ cell tumors.

Anticancer Peptides advanced

Bleomycin: Oligopeptide Research Reference

Glycopeptide antibiotic used as a chemotherapeutic agent that induces DNA strand breaks via metal-dependent oxidative cleavage.

Anticancer Peptides advanced

BLI Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using BLI. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

Blood Disorders and Peptides: Comprehensive Peptide Refer...

Learn about peptide-based treatments for hematological conditions including thrombocytopenia and anemia. This peptide or oligopeptide is studied for its biol...

Peptide Therapeutics intermediate

Blueberry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from blueberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

BM32: Oligopeptide Research Reference

BM32, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

BMAP-27: Oligopeptide Research Reference

BMAP-27, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

BMAP-28: Oligopeptide Research Reference

BMAP-28, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

BmK AGAP: Peptide Toxin in Pharmacology Reference

BmK AGAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

BMP 2 Hormone: Endogenous Peptide Hormone Reference

BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 2 Peptide Hormone: Endogenous Peptide Hormone Reference

BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 2 Protein Hormone: Endogenous Peptide Hormone Reference

BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 2: Endogenous Peptide Hormone Reference

BMP-2 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...

Peptide Hormones intermediate

BMP 4 Hormone: Endogenous Peptide Hormone Reference

BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 4 Peptide Hormone: Endogenous Peptide Hormone Reference

BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 4 Protein Hormone: Endogenous Peptide Hormone Reference

BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 4: Endogenous Peptide Hormone Reference

BMP-4 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...

Peptide Hormones intermediate

BMP 7 Hormone: Endogenous Peptide Hormone Reference

BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 7 Peptide Hormone: Endogenous Peptide Hormone Reference

BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 7 Protein Hormone: Endogenous Peptide Hormone Reference

BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

BMP 7: Endogenous Peptide Hormone Reference

BMP-7 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...

Peptide Hormones intermediate

BMP Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting BMP Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

BNP → Neprilysin (Substrate): Comprehensive Peptide Refer...

BNP as a substrate for neprilysin enzyme, relevant to sacubitril/valsartan heart failure therapy. This peptide or oligopeptide is studied for its biological ...

Peptide Interactions intermediate

BNP 1-32: Peptide Fragment Reference

Comprehensive reference for BNP 1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 10-32: Peptide Fragment Reference

Comprehensive reference for BNP 10-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 13-32: Peptide Fragment Reference

Comprehensive reference for BNP 13-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 18-32: Peptide Fragment Reference

Comprehensive reference for BNP 18-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 22-32: Peptide Fragment Reference

Comprehensive reference for BNP 22-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 26-32: Peptide Fragment Reference

Comprehensive reference for BNP 26-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 28-32: Peptide Fragment Reference

Comprehensive reference for BNP 28-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 3-32: Peptide Fragment Reference

Comprehensive reference for BNP 3-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 32: Endogenous Peptide Hormone Reference

BNP-32 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...

Peptide Hormones intermediate

BNP 32: Oligopeptide Research Reference

BNP 32 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Cardiovascular Peptides intermediate

BNP 5-32: Peptide Fragment Reference

Comprehensive reference for BNP 5-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 7-32: Peptide Fragment Reference

Comprehensive reference for BNP 7-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP 8-32: Peptide Fragment Reference

Comprehensive reference for BNP 8-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Cardiovascular Peptides intermediate

BNP Hormone: Endogenous Peptide Hormone Reference

BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

BNP Peptide Hormone: Endogenous Peptide Hormone Reference

BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

BNP Protein Hormone: Endogenous Peptide Hormone Reference

BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

BNP: Oligopeptide Research Reference

32-amino acid natriuretic peptide cleaved from 108-aa proBNP precursor by furin-like proteases. Released by cardiac ventricles in response to volume overload...

Peptide Therapeutics intermediate

Boc Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Boc for producing peptides with specific properties. This analytical technique provides valuable insights into peptide struc...

Peptide Synthesis Methods advanced

Bombesin: Neuropeptide in Neuroscience Reference

A tetradecapeptide originally isolated from frog skin that binds bombesin/GRP receptors and regulates growth, feeding, and cancer biology.

Neuropeptides intermediate

bond-angle Resource: Oligopeptide Research Reference

The bond-angle database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ac...

Databases & Resources intermediate

bond-length Resource: Oligopeptide Research Reference

The bond-length database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Bone / Calcitonin Analog: Oligopeptide Research Reference

Bone / Calcitonin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Therapeutic Peptides Expanded intermediate

Bone / Calcitonin: Oligopeptide Research Reference

Bone / Calcitonin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ...

Therapeutic Peptides intermediate

Bone Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Bone Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Bone Disorders: Oligopeptide Research Reference

Peptide therapeutics for osteoporosis and bone healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Bone Morphogenetic Protein BMP-10

Comprehensive reference for bone morphogenetic protein BMP-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-12

Comprehensive reference for bone morphogenetic protein BMP-12, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-13

Comprehensive reference for bone morphogenetic protein BMP-13, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-14

Comprehensive reference for bone morphogenetic protein BMP-14, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-15

Comprehensive reference for bone morphogenetic protein BMP-15, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-16

Comprehensive reference for bone morphogenetic protein BMP-16, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-17

Comprehensive reference for bone morphogenetic protein BMP-17, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-2

Comprehensive reference for bone morphogenetic protein BMP-2, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-4

Comprehensive reference for bone morphogenetic protein BMP-4, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-5

Comprehensive reference for bone morphogenetic protein BMP-5, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-6

Comprehensive reference for bone morphogenetic protein BMP-6, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-7

Comprehensive reference for bone morphogenetic protein BMP-7, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-8a

Comprehensive reference for bone morphogenetic protein BMP-8a, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-8b

Comprehensive reference for bone morphogenetic protein BMP-8b, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bone Morphogenetic Protein BMP-9

Comprehensive reference for bone morphogenetic protein BMP-9, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Bortezomib Proteasome Inhibition

Detailed mechanism of boronic acid dipeptide bortezomib inhibiting the 26S proteasome in multiple myeloma. This peptide or oligopeptide is studied for its bi...

Anticancer Peptides advanced

Bortezomib: Oligopeptide Research Reference

Boronic acid proteasome inhibitor that blocks 26S proteasome activity, used for multiple myeloma and mantle cell lymphoma.

Anticancer Peptides advanced

Bortezomib: Oligopeptide Research Reference

bortezomib in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Botulinum Neurotoxin (BoNT): Comprehensive Peptide Reference

Comprehensive reference for Botulinum Neurotoxin (BoNT), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

Botulinum Neurotoxin (α-toxin / BoNT)

Comprehensive reference for Botulinum Neurotoxin (α-toxin / BoNT), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

Botulinum Toxin A: Oligopeptide Research Reference

Botulinum Toxin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Botulinum Toxin B: Oligopeptide Research Reference

Botulinum Toxin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Bovine Antimicrobial: Oligopeptide Research Reference

Bovine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Mammalian Peptides intermediate

Bovine Cathelicidin BMAP-28: Comprehensive Peptide Reference

Cathelicidin from bovine neutrophils with broad-spectrum antimicrobial properties. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides intermediate

Bowman-Birk Inhibitor: Oligopeptide Research Reference

Bowman-Birk Inhibitor, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Bradykinin → ACE (Substrate): Comprehensive Peptide Refer...

Comprehensive reference for Bradykinin → ACE (Substrate), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Bradykinin 1 7: Oligopeptide Research Reference

bradykinin 1 7 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Cardiovascular Peptides intermediate

Bradykinin Family Peptides: Comprehensive Peptide Reference

Overview of bradykinin and kallidin peptides in inflammation, pain, and vascular permeability. This peptide or oligopeptide is studied for its biological act...

Peptide Families intermediate

Bradykinin: A Mediator of Inflammation and Vascular Tone

An exploration of bradykinin, a nonapeptide kinin that regulates vasodilation, inflammation, and pain signaling through B1 and B2 receptors.

Nonapeptides intermediate

BRAF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting BRAF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

Brain Derived Growth Factor 1-119

Comprehensive reference for brain derived growth factor 1-119, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor 1-30

Comprehensive reference for brain derived growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor 1-50

Comprehensive reference for brain derived growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor 1-70

Comprehensive reference for brain derived growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor 1-90

Comprehensive reference for brain derived growth factor 1-90, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor fragment-1-10

Comprehensive reference for brain derived growth factor fragment-1-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor fragment-20-50

Comprehensive reference for brain derived growth factor fragment-20-50, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Derived Growth Factor fragment-50-119

Comprehensive reference for brain derived growth factor fragment-50-119, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Brain Natriuretic Peptide: Comprehensive Peptide Reference

Brain natriuretic peptide is a cardiac neurohormone that promotes natriuresis and vasodilation, serving as a critical biomarker and therapeutic target in hea...

Cardiovascular intermediate

Branched peptide: Oligopeptide Research Reference

Comprehensive reference for branched peptide, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Branched System 1: Oligopeptide Research Reference

A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Branched System 2: Oligopeptide Research Reference

A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Branched System 3: Oligopeptide Research Reference

A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Brazzein: Oligopeptide Research Reference

brazzein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Agricultural Peptides intermediate

Breast Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Breast Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...

Disease-Associated Peptides intermediate

Breast Cancer: Oligopeptide Research Reference

Malignant proliferation of breast epithelial cells. Most common cancer in women worldwide. Molecular subtypes: Luminal A (ER+/PR+/HER2-, best prognosis), Lum...

Peptide Therapeutics intermediate

Bremelanotide: Oligopeptide Research Reference

Melanocortin MC4R agonist for hypoactive sexual desire disorder in premenopausal women. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Drugs intermediate

Brentuximab Vedotin: Oligopeptide Research Reference

Anti-CD30 antibody-drug conjugate with MMAE payload for Hodgkin lymphoma and anaplastic large cell lymphoma. This peptide or oligopeptide is studied for its ...

Peptide-Drug Conjugates advanced

BRET for Peptides: Analytical Technique in Peptide Research

Application of BRET technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...

Structural Biology Techniques advanced

Brevinin 1e: Antimicrobial Peptide Reference

brevinin-1e is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Brevinin 1J: Antimicrobial Peptide Reference

brevinin-1J is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Brevinin 2e: Structure, Function, and Significance

Brevinin-2 peptides are shorter members of the brevinin family with enhanced selectivity for bacterial over mammalian membranes.

Antimicrobial Peptides intermediate

Brevinin 2Eb: Antimicrobial Peptide Reference

brevinin-2Eb is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...

Antimicrobial Peptides intermediate

Brevinin 2RTa: Antimicrobial Peptide Reference

brevinin-2RTa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...

Antimicrobial Peptides intermediate

Brevinin-1: Antimicrobial Peptide Reference

Amphibian antimicrobial peptide with potent activity against drug-resistant bacteria and anticancer properties. Covers molecular mechanisms, biological activ...

Antimicrobial Peptides intermediate

Brevinin-1: Antimicrobial Peptide Reference

Frog skin AMP with C-terminal cyclic heptapeptide disulfide bridge for bactericidal activity. This antimicrobial peptide demonstrates activity against pathog...

Antimicrobial Peptides intermediate

Brevinin-2: Antimicrobial Peptide Reference

Potent frog AMP with broader spectrum than brevinin-1 and activity against resistant bacteria. This antimicrobial peptide demonstrates activity against patho...

Antimicrobial Peptides intermediate

Brevinin: Structure, Function, and Significance

Brevinins are cyclic antimicrobial peptides from frog skin with a characteristic C-terminal ester bond creating a cyclic heptapeptide ring.

Antimicrobial Peptides intermediate

Brilacidin: Oligopeptide Research Reference

Brilacidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Broccoli Peptide: Oligopeptide Research Reference

A bioactive peptide derived from broccoli with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

Bromoacetyl Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Bromoacetyl. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

Brownian Dynamics for Peptides

A computational method for studying peptides using Brownian Dynamics. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Bruker AVANCE III HD: Oligopeptide Research Reference

High-field NMR spectrometer (600-950 MHz) for protein structure determination. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

Bruker timsTOF Pro 2: Oligopeptide Research Reference

Trapped ion mobility TOF mass spectrometer. High-resolution proteomics. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Bt Toxin Cry1Ab: Oligopeptide Research Reference

Bt toxin Cry1Ab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Agricultural Peptides intermediate

Bt Toxin Cry1Ac: Oligopeptide Research Reference

Bt toxin Cry1Ac in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Agricultural Peptides intermediate

Bt Toxin Cry2Ab: Oligopeptide Research Reference

Bt toxin Cry2Ab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Agricultural Peptides intermediate

Bt Toxin Vip3A: Oligopeptide Research Reference

Bt toxin Vip3A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Agricultural Peptides intermediate

BT1718: Oligopeptide Research Reference

BT1718, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

BT5528: Oligopeptide Research Reference

BT5528, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

Buccal Peptide Delivery: Oligopeptide Research Reference

Buccal adhesive systems for sustained peptide delivery through cheek mucosa. This peptide or oligopeptide is studied for its biological activity, structure-a...

Drug Delivery intermediate

Buprenorphine Partial Agonist: Comprehensive Peptide Refe...

Semi-synthetic partial mu-agonist and kappa-antagonist for addiction treatment. This neuropeptide is involved in neurological signaling and is studied for it...

Neuropeptides beginner

Buprenorphine: Oligopeptide Research Reference

Buprenorphine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

buried-surface-area Resource: Comprehensive Peptide Refer...

The buried-surface-area database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Bursicon: Oligopeptide Research Reference

Bursicon, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Buserelin: Oligopeptide Research Reference

Potent GnRH agonist with D-Ser(tBu) modification for nasal and subcutaneous administration. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs intermediate

Buserelin: Oligopeptide Research Reference

buserelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

By Monitoring Frequency: Oligopeptide Research Reference

By Monitoring Frequency, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Safety intermediate

By Regulatory Burden: Oligopeptide Research Reference

By Regulatory Burden, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Safety intermediate

By Severity: Oligopeptide Research Reference

By Severity, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Safety intermediate

C Botulinum Peptide: Oligopeptide Research Reference

A peptide associated with C Botulinum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

C Difficile Peptide: Oligopeptide Research Reference

A peptide associated with C Difficile for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

C Diphtheriae Peptide: Oligopeptide Research Reference

A peptide associated with C Diphtheriae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

C Jejuni Peptide: Oligopeptide Research Reference

A peptide associated with C Jejuni for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

C MET Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting C MET Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

C MET Inhibitor: Oligopeptide Research Reference

c MET inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Signaling Peptides intermediate

C Myc Tag Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using C Myc Tag. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

C Perfringens Peptide: Oligopeptide Research Reference

A peptide associated with C Perfringens for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

C Terminal Mod System 1: Oligopeptide Research Reference

A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

C Terminal Mod System 2: Oligopeptide Research Reference

A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

C Terminal Mod System 3: Oligopeptide Research Reference

A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

C Tetani Peptide: Oligopeptide Research Reference

A peptide associated with C Tetani for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

C Trachomatis Peptide: Oligopeptide Research Reference

A peptide associated with C Trachomatis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

C-Peptide Relationship: Oligopeptide Research Reference

Equimolar production of C-peptide with insulin from proinsulin cleavage as endogenous secretion marker. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs intermediate

C-Peptide: Oligopeptide Research Reference

31-amino acid connecting peptide cleaved from proinsulin, used as a marker of endogenous insulin secretion. This peptide or oligopeptide is studied for its b...

Pancreatic Peptides beginner

C-Terminal Amidation: Oligopeptide Research Reference

Addition of amide group at C-terminus. Protects against exopeptidase degradation. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

C-Terminal PEGylation: Post-Translational Modification Re...

C-Terminal PEGylation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Modifications intermediate

CA 15-3: Peptide Fragment Reference

MUC1 glycoprotein. Breast cancer biomarker for treatment monitoring. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Therapeutics intermediate

CA 19-9: Peptide Fragment Reference

Sialyl-Lewis(a) carbohydrate antigen (CA 19-9). Elevated in pancreatic cancer (80%), bile duct cancer, gastric cancer. Normal: <37 U/mL. Used for monitoring ...

Peptide Therapeutics intermediate

CA-125 (MUC16): Oligopeptide Research Reference

MUC16 gene product, ~3.5 MDa transmembrane glycoprotein. Overexpressed in ovarian epithelial cancer. Normal: <35 U/mL. Used for monitoring ovarian cancer tre...

Peptide Therapeutics intermediate

CA-125 (MUC16): Oligopeptide Research Reference

Mucin-type glycoprotein, overexpressed in ovarian cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...

Peptide Therapeutics intermediate

Cabbage Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cabbage with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Caerulein: Antimicrobial Peptide Reference

Caerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Calciseptine: Structure, Function, and Significance

Calciseptine from black mamba venom blocks L-type calcium channels, causing hypotension and bradycardia. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Calcitonin amylin-1-37: Endogenous Peptide Hormone Reference

Comprehensive reference for calcitonin amylin-1-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin bovine-1-32: Endogenous Peptide Hormone Reference

Comprehensive reference for calcitonin bovine-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin eel-1-32: Endogenous Peptide Hormone Reference

Comprehensive reference for calcitonin eel-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin Family Peptides: Comprehensive Peptide Reference

Learn about calcitonin, amylin, and CGRP in the calcitonin peptide family and their metabolic roles. This peptide or oligopeptide is studied for its biologic...

Peptide Families intermediate

Calcitonin fragment-1-7: Endogenous Peptide Hormone Refer...

Comprehensive reference for calcitonin fragment-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin fragment-16-22: Comprehensive Peptide Reference

Comprehensive reference for calcitonin fragment-16-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin fragment-23-32: Comprehensive Peptide Reference

Comprehensive reference for calcitonin fragment-23-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin fragment-8-15: Endogenous Peptide Hormone Refe...

Comprehensive reference for calcitonin fragment-8-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin Gene Related: Neuropeptide in Neuroscience Ref...

calcitonin-gene-related is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. Covers molecular mechanisms, biological act...

Neuropeptides intermediate

Calcitonin Gene-Related Peptide

37-amino acid neuropeptide potent vasodilator involved in migraine pathophysiology and pain signaling. This peptide or oligopeptide is studied for its biolog...

Neuropeptides intermediate

Calcitonin Hormone: Endogenous Peptide Hormone Reference

Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Calcitonin human-1-32: Endogenous Peptide Hormone Reference

Comprehensive reference for calcitonin human-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin Peptide Hormone: Comprehensive Peptide Reference

Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Calcitonin porcine-1-32: Endogenous Peptide Hormone Refer...

Comprehensive reference for calcitonin porcine-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin Protein Hormone: Comprehensive Peptide Reference

Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Calcitonin salmon-1-32: Endogenous Peptide Hormone Reference

Comprehensive reference for calcitonin salmon-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Calcitonin Salmon: Oligopeptide Research Reference

Synthetic salmon calcitonin for osteoporosis and Paget's disease, inhibiting osteoclast-mediated bone resorption. Covers molecular mechanisms, biological act...

Bone-Active Peptides beginner

Calcitonin Salmon: Oligopeptide Research Reference

calcitonin salmon in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Peptide Drugs intermediate

Calcitonin: Oligopeptide Research Reference

Calcitonin is a 32-amino acid peptide hormone produced by thyroid C cells that regulates calcium homeostasis and serves as a therapeutic agent for osteoporos...

Peptide Hormones intermediate

Calpain Inhibitor: Enzyme in Peptide Biology Reference

calpain inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate speci...

Enzyme Peptides intermediate

Calprotectin (S100A8/A9): Oligopeptide Research Reference

S100A8 (8.5 kDa, 93 aa) + S100A9 (12.4 kDa, 114 aa) heterodimer. Neutrophil-derived calcium-binding protein comprising ~40% of cytosolic protein in neutrophi...

Peptide Therapeutics intermediate

CaMK Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

CaMK Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

CaMK Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

CaMK Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

CaMK Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Cancer / HPV-Associated: Oligopeptide Research Reference

Cancer / HPV-Associated is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...

Peptide Vaccines intermediate

Cancer / Immune Modulatory: Comprehensive Peptide Reference

Cancer / Immune Modulatory is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...

Peptide Vaccines intermediate

Cancer / Personalized Neoantigen

Cancer / Personalized Neoantigen is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...

Peptide Vaccines intermediate

Cancer and Peptides: Oligopeptide Research Reference

Learn about peptide-based cancer therapies including targeted drug conjugates, immunomodulatory peptides, and tumor-homing peptides.

Peptide Therapeutics advanced

Cancer Immunotherapy Peptides: Neoantigen Vaccines and Ch...

Explore peptide-based cancer immunotherapy approaches including personalized neoantigen vaccines and checkpoint inhibitor peptidomimetics.

Cancer Immunotherapy advanced

Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Cancer Treatment: Oligopeptide Research Reference

Multimodal approach: surgery (local control), radiation therapy (local control), chemotherapy (systemic cytotoxic), targeted therapy (molecular targets), imm...

Peptide Therapeutics intermediate

Cancer: Oligopeptide Research Reference

Screening, monitoring, recurrence detection. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Biomarkers Expanded intermediate

Candida albicans target: Oligopeptide Research Reference

Binds Ssa1p on candida surface, induces ROS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Yeast Peptides intermediate

Candida glabrata: Oligopeptide Research Reference

Disrupts cell wall integrity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Yeast Peptides intermediate

Canine Antimicrobial: Oligopeptide Research Reference

Canine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Mammalian Peptides intermediate

Canine Beta-Defensin: Oligopeptide Research Reference

Canine Beta-Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Canine Defensin: Oligopeptide Research Reference

Canine Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Canine Neutrophil Peptide: Comprehensive Peptide Reference

Comprehensive reference for Canine Neutrophil Peptide, a peptide compound with applications in research and therapeutics.

Mammalian Peptides intermediate

Canine Serum Peptide: Oligopeptide Research Reference

Canine Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Capillary Electrophoresis Analysis

An analytical technique for characterizing peptides using Capillary Electrophoresis. This analytical technique provides valuable insights into peptide struct...

Analytical Techniques advanced

Capillary Electrophoresis for Peptides

Explore capillary electrophoresis techniques for high-resolution separation and analysis of peptide mixtures. This peptide or oligopeptide is studied for its...

Peptide Analysis intermediate

Capreomycin: Oligopeptide Research Reference

Capreomycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Captopril: Oligopeptide Research Reference

First oral ACE inhibitor derived from Brazilian pit viper venom, containing a thiol group for angiotensin-converting enzyme inhibition.

Cardiovascular Peptides beginner

Captopril: Oligopeptide Research Reference

Captopril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Car T Target BCMA: Oligopeptide Research Reference

Comprehensive reference for car t target BCMA, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD123: Oligopeptide Research Reference

Comprehensive reference for car t target CD123, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD133: Oligopeptide Research Reference

Comprehensive reference for car t target CD133, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD138: Oligopeptide Research Reference

Comprehensive reference for car t target CD138, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD19: Oligopeptide Research Reference

Comprehensive reference for car t target CD19, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD20: Oligopeptide Research Reference

Comprehensive reference for car t target CD20, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD22: Oligopeptide Research Reference

Comprehensive reference for car t target CD22, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD30: Oligopeptide Research Reference

Comprehensive reference for car t target CD30, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD33: Oligopeptide Research Reference

Comprehensive reference for car t target CD33, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD38: Oligopeptide Research Reference

Comprehensive reference for car t target CD38, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD44: Oligopeptide Research Reference

Comprehensive reference for car t target CD44, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD5: Oligopeptide Research Reference

Comprehensive reference for car t target CD5, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD7: Oligopeptide Research Reference

Comprehensive reference for car t target CD7, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target CD70: Oligopeptide Research Reference

Comprehensive reference for car t target CD70, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target Claudin18.2: Oligopeptide Research Reference

Comprehensive reference for car t target Claudin18.2, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target EGFR: Oligopeptide Research Reference

Comprehensive reference for car t target EGFR, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target GPC3: Oligopeptide Research Reference

Comprehensive reference for car t target GPC3, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target HER2: Oligopeptide Research Reference

Comprehensive reference for car t target HER2, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target Mesothelin: Oligopeptide Research Reference

Comprehensive reference for car t target Mesothelin, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Car T Target NKG2D: Oligopeptide Research Reference

Comprehensive reference for car t target NKG2D, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Carbetocin: Oligopeptide Research Reference

Long-acting oxytocin analog for postpartum hemorrhage prevention with D-Tyr substitution. This peptide or oligopeptide is studied for its biological activity...

Peptide Drugs intermediate

Carbohydrate Conjugate System 1

A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Carbohydrate Conjugate System 2

A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Carbohydrate Conjugate System 3

A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Carbohydrate Conjugation Synthesis

A peptide synthesis method using Carbohydrate Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...

Peptide Synthesis Methods advanced

Carcinoma Peptides: Oligopeptide Research Reference

Peptides associated with Carcinoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...

Disease-Associated Peptides intermediate

Cardiac Troponin I: Oligopeptide Research Reference

209-aa regulatory protein of cardiac muscle thin filament. Cardiac-specific isoform (cTnI) encoded by TNNI3 gene. Released upon myocardial cell death. Normal...

Peptide Therapeutics intermediate

Cardiac Troponin T: Oligopeptide Research Reference

298-aa structural protein of cardiac muscle thin filament. Cardiac-specific isoform (cTnT) encoded by TNNT2 gene. Released upon myocardial injury. Normal: <1...

Peptide Therapeutics intermediate

Cardiac: Oligopeptide Research Reference

MI diagnosis, HF assessment, coagulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Biomarkers Expanded intermediate

Cardiomyopathy: Oligopeptide Research Reference

Disease of the heart muscle leading to impaired cardiac function. Types: dilated (DCM), hypertrophic (HCM), restrictive (RCM), arrhythmogenic (ARVC). Treatme...

Peptide Therapeutics intermediate

Cardiotoxicity: Oligopeptide Research Reference

Heart damage caused by peptide drugs. Can include arrhythmias and cardiomyopathy. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Cardiovascular / ACE Inhibitor (peptide-derived)

Cardiovascular / ACE Inhibitor (peptide-derived) is a bioactive compound with applications in peptide research and therapeutics.

Therapeutic Peptides Expanded intermediate

Cardiovascular / Anticoagulant

Cardiovascular / Anticoagulant is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...

Therapeutic Peptides intermediate

Cardiovascular / Anticoagulant Peptide

Cardiovascular / Anticoagulant Peptide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologica...

Therapeutic Peptides Expanded intermediate

Cardiovascular / Kinin System: Comprehensive Peptide Refe...

Cardiovascular / Kinin System is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Peptide Interactions intermediate

Cardiovascular Disease: Oligopeptide Research Reference

Diseases of the heart and blood vessels: coronary artery disease, heart failure, arrhythmias, hypertension, peripheral vascular disease. Leading cause of dea...

Peptide Therapeutics intermediate

Cardiovascular Peptides: Oligopeptide Research Reference

Peptides associated with Cardiovascular including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...

Disease-Associated Peptides intermediate

Cardiovascular: Oligopeptide Research Reference

Natriuretic peptides, troponins, coagulation factors. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...

Peptide Diseases intermediate

Carfentanil Veterinary: Neuropeptide in Neuroscience Refe...

Most potent commercially available synthetic opioid for large animal use. This neuropeptide is involved in neurological signaling and is studied for its role...

Neuropeptides intermediate

Carfilzomib Proteasome Inhibitor

Irreversible epoxyketone proteasome inhibitor derived from natural product epoxomicin for multiple myeloma treatment. Covers molecular mechanisms, biological...

Anticancer Peptides advanced

Carfilzomib: Oligopeptide Research Reference

Epoxyketone proteasome inhibitor that irreversibly inhibits the 20S proteasome for relapsed multiple myeloma. This peptide or oligopeptide is studied for its...

Anticancer Peptides advanced

Carnosine Analog: Oligopeptide Research Reference

carnosine analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Antioxidant Peptides intermediate

Carnosine: Short Peptide in Biochemistry Reference

Carnosine is a naturally occurring dipeptide composed of beta-alanine and L-histidine, functioning as an intracellular pH buffer, antioxidant, and anti-glyca...

Dipeptides beginner

Carp NPY: Oligopeptide Research Reference

Carp NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Carperitide: Oligopeptide Research Reference

Recombinant human atrial natriuretic peptide used in Japan for acute decompensated heart failure. This peptide or oligopeptide is studied for its biological ...

Cardiovascular Peptides intermediate

Carrot Peptide: Oligopeptide Research Reference

A bioactive peptide derived from carrot with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Cashew Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cashew with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Casimersen: Oligopeptide Research Reference

Casimersen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Casocidin: Oligopeptide Research Reference

Casocidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Casokinin 1: Oligopeptide Research Reference

casokinin-1 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Casokinin 2: Oligopeptide Research Reference

casokinin-2 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Casokinin: Structure, Function, and Significance

Casokinins are ACE-inhibitory peptides derived from casein during digestion. They contribute to the antihypertensive effects of milk.

Food-Derived Peptides intermediate

Casomorphin: Oligopeptide Research Reference

Opioid peptides derived from casein (milk protein). β-casomorphin-7 (Tyr-Pro-Phe-Pro-Gly-Pro-Ile) is most studied. Activates mu-opioid receptors. May affect ...

Peptide Therapeutics intermediate

Casoxin C: Oligopeptide Research Reference

Casein-derived opioid antagonist. Found in milk protein digests. May counteract casomorphin effects. Part of the endogenous opioid balance in milk consumption.

Peptide Therapeutics intermediate

Caspofungin: Oligopeptide Research Reference

Echinocandin antifungal that inhibits beta-1,3-D-glucan synthase, disrupting fungal cell wall integrity in Candida and Aspergillus.

Antifungal Peptides advanced

Caspofungin: Oligopeptide Research Reference

Echinocandin antifungal inhibiting beta-1,3-glucan synthase for invasive candidiasis. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs intermediate

Caspofungin: Oligopeptide Research Reference

caspofungin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Casting Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Casting for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...

Peptide Synthesis Methods advanced

Cat-PAD: Oligopeptide Research Reference

Cat-PAD, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Catalase Mimetic: Oligopeptide Research Reference

catalase mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Antioxidant Peptides intermediate

Category: Oligopeptide Research Reference

Primary Activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Bacterial Peptides intermediate

CATH Resource: Oligopeptide Research Reference

The CATH database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

Cathelicidin FF-16: Antimicrobial Peptide Reference

Short synthetic antimicrobial peptide from LL-37 with potent bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is...

Antimicrobial Peptides intermediate

Cathelicidin KR-12: Antimicrobial Peptide Reference

Minimum active antimicrobial fragment of LL-37 with reduced cytotoxicity. This antimicrobial peptide demonstrates activity against pathogens and is studied f...

Antimicrobial Peptides intermediate

Cathelicidin LL-37: Antimicrobial Peptide Reference

Only human cathelicidin with broad-spectrum antimicrobial and immunomodulatory properties. This antimicrobial peptide demonstrates activity against pathogens...

Antimicrobial Peptides intermediate

Cathepsin Inhibitor: Enzyme in Peptide Biology Reference

cathepsin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spe...

Enzyme Peptides intermediate

Cauliflower Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cauliflower with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-a...

Plant-Derived Peptides intermediate

CBD Tag Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using CBD Tag. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

CCK 10: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 11: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 11 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 12: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 12 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 14: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 22: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 25: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 25 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 33: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 33 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 4: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 5: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 58: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 58 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 6: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 65: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 65 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 7: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 70: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 70 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 83: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 83 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK 9: Neuropeptide in Neuroscience Reference

Comprehensive reference for CCK 9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CCK Anxiety: Neuropeptide in Neuroscience Reference

Central CCK effects on anxiety and panic through CCK-B receptors. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...

Neuropeptides intermediate

CCK Hormone: Endogenous Peptide Hormone Reference

CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CCK Peptide Hormone: Endogenous Peptide Hormone Reference

CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CCK Protein Hormone: Endogenous Peptide Hormone Reference

CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CCK-8 (Sulfated): Neuropeptide in Neuroscience Reference

CCK-8 (Sulfated), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

CD Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using CD. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Analytical Techniques advanced

CD-spectroscopy for Peptides: Comprehensive Peptide Refer...

Application of CD-spectroscopy technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...

Structural Biology Techniques advanced

CD200 Agonist: Oligopeptide Research Reference

CD200 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

CD27 Agonist: Oligopeptide Research Reference

CD27 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

CD28 Agonist: Oligopeptide Research Reference

CD28 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

CD40 Agonist: Oligopeptide Research Reference

CD40 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

CD47 Blocker: Oligopeptide Research Reference

CD47 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

CE MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using CE MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

CE-align Resource: Oligopeptide Research Reference

The CE-align database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

CEA: Oligopeptide Research Reference

184 kDa glycosylated cell adhesion molecule. Overexpressed in adenocarcinomas (colorectal, pancreatic, gastric, lung). Normal: <2.5 ng/mL (non-smokers), <5.0...

Peptide Therapeutics intermediate

Cecropin / Antimicrobial: Oligopeptide Research Reference

Cecropin / Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Insect Peptides intermediate

Cecropin A (Hyalophora): Oligopeptide Research Reference

Cecropin A (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Cecropin A: Antimicrobial Peptide Reference

Insect antimicrobial peptide from the cecropia moth that pioneered innate immunity research and inspired peptide antibiotic development.

Antimicrobial Peptides beginner

Cecropin A: Antimicrobial Peptide Reference

Cationic alpha-helical AMP from giant silk moth with gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens ...

Antimicrobial Peptides intermediate

Cecropin AD (Hybrid): Oligopeptide Research Reference

Cecropin AD (Hybrid), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Cecropin B (Hyalophora): Oligopeptide Research Reference

Cecropin B (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Cecropin B: Antimicrobial Peptide Reference

AMP from Hyalophora cecropia with potent gram-negative and some antifungal activity. This antimicrobial peptide demonstrates activity against pathogens and i...

Antimicrobial Peptides intermediate

Cecropin D (Hyalophora): Oligopeptide Research Reference

Cecropin D (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Cecropin P1 (Sus scrofa): Oligopeptide Research Reference

Comprehensive reference for Cecropin P1 (Sus scrofa), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

Cecropin P1: Antimicrobial Peptide Reference

AMP from pig intestine with broad-spectrum activity against enteric pathogens. This antimicrobial peptide demonstrates activity against pathogens and is stud...

Antimicrobial Peptides intermediate

Cecropin-Drosomycin Hybrid: Comprehensive Peptide Reference

Engineered hybrid combining cecropin and drosomycin for dual activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...

Antimicrobial Peptides advanced

Cecropin: Antimicrobial Peptide Reference

A family of antibacterial peptides first isolated from the giant silk moth Hyalophora cecropia, characterized by their linear structure and potent activity a...

Antimicrobial Peptides intermediate

Cecropins: Oligopeptide Research Reference

Broad-spectrum antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Insect Peptides intermediate

Ceftazidime/Avibactam: Oligopeptide Research Reference

Ceftazidime/Avibactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Celery Peptide: Oligopeptide Research Reference

A bioactive peptide derived from celery with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Celiac Peptides: Oligopeptide Research Reference

Peptides associated with Celiac including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Cell adhesion: Oligopeptide Research Reference

Comprehensive reference for cell adhesion, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Cell Free Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Cell Free for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Cell migration: Oligopeptide Research Reference

Comprehensive reference for cell migration, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Cell signaling: Oligopeptide Research Reference

Comprehensive reference for cell signaling, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Cell Sorting Analysis: Analytical Technique in Peptide Re...

An analytical technique for characterizing peptides using Cell Sorting. This analytical technique provides valuable insights into peptide structure, purity, ...

Analytical Techniques advanced

Cell-Free Protein Synthesis: Comprehensive Peptide Reference

In vitro transcription/translation using cell extracts. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Cell-Penetrating Peptides for Delivery

Explore CPP-mediated intracellular delivery of cargo peptides across cell membranes. This peptide or oligopeptide is studied for its biological activity, str...

Drug Delivery advanced

Cell-Penetrating Peptides: Comprehensive Peptide Reference

Peptides that can cross cell membranes. Used for intracellular drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

Cemiplimab: Oligopeptide Research Reference

cemiplimab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Centrifugal Separation Purification

A purification technique for separating and isolating peptides using Centrifugal Separation. This analytical technique provides valuable insights into peptid...

Purification Methods advanced

Centrifugal Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using Centrifugal for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

centrifugation for Peptides: Comprehensive Peptide Reference

Application of centrifugation technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Cephalosporin: Oligopeptide Research Reference

Cephalosporin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Cerliponase Alfa: Oligopeptide Research Reference

Cerliponase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Certolizumab: Oligopeptide Research Reference

certolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Cerulein: Antimicrobial Peptide Reference

Cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Cervical Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Cervical Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...

Disease-Associated Peptides intermediate

Cetrorelix: Oligopeptide Research Reference

Injectable GnRH antagonist used in IVF protocols to prevent premature ovulation and in prostate cancer treatment. Covers molecular mechanisms, biological act...

Hormone Antagonists advanced

Cetrorelix: Oligopeptide Research Reference

cetrorelix in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Cetuximab: Oligopeptide Research Reference

cetuximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Ceyciganin 1: Oligopeptide Research Reference

ceyciganin-1 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.

Plant Peptides intermediate

Ceyciganin 2: Oligopeptide Research Reference

ceyciganin-2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.

Plant Peptides intermediate

CgA (Conus geographus): Oligopeptide Research Reference

CgA (Conus geographus), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

CGRP → CGRP Receptor: Oligopeptide Research Reference

CGRP → CGRP Receptor, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

CGRP 22-37: Peptide Fragment Reference

Comprehensive reference for CGRP 22-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CGRP 8-37: Peptide Fragment Reference

Comprehensive reference for CGRP 8-37 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

CGRP Alpha: Neuropeptide in Neuroscience Reference

Calcitonin gene-related peptide mediating vasodilation and pain transmission in trigeminal system. This neuropeptide is involved in neurological signaling an...

Neuropeptides intermediate

CGRP Beta: Neuropeptide in Neuroscience Reference

Beta isoform of CGRP with similar vasodilatory and neuromodulatory functions. This neuropeptide is involved in neurological signaling and is studied for its ...

Neuropeptides intermediate

CGRP Family Peptides: Oligopeptide Research Reference

Explore calcitonin gene-related peptide family in migraine pathophysiology and vascular biology. This peptide or oligopeptide is studied for its biological a...

Peptide Families intermediate

CGRP Fragment: Oligopeptide Research Reference

CGRP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Cardiovascular Peptides intermediate

CGRP Hormone: Endogenous Peptide Hormone Reference

CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CGRP in Migraine: Oligopeptide Research Reference

An analysis of the calcitonin gene-related peptide pathway in migraine pathophysiology, including monoclonal antibody therapies and small-molecule gepants ta...

Neurology intermediate

CGRP Peptide Hormone: Endogenous Peptide Hormone Reference

CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CGRP Protein Hormone: Endogenous Peptide Hormone Reference

CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CGRP Receptor Pharmacology: Comprehensive Peptide Reference

Molecular pharmacology of CGRP receptor including RAMP1 interaction and signal transduction. This peptide or oligopeptide is studied for its biological activ...

Peptide Drugs advanced

CGRP(28 37): Neuropeptide in Neuroscience Reference

CGRP(28-37) is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...

Neuropeptides intermediate

CGRP8 37: Neuropeptide in Neuroscience Reference

CGRP8-37 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This neuropeptide is involved in neurological signaling an...

Neuropeptides intermediate

Chameleon Cathelicidin: Oligopeptide Research Reference

Chameleon Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Chameleon Chromatophore Regulatory Peptide

Comprehensive reference for Chameleon Chromatophore Regulatory Peptide, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Chameleon Color-Change Peptide

Comprehensive reference for Chameleon Color-Change Peptide, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Chameleon Defensin: Oligopeptide Research Reference

Chameleon Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Chameleon Peptides: Oligopeptide Research Reference

Antimicrobial, Pigmentation, Drug Discovery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Reptile Peptides intermediate

Chameleon Skin Peptide: Oligopeptide Research Reference

Chameleon Skin Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Chameleon Venom Peptide: Oligopeptide Research Reference

Chameleon Venom Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Characterization (5 processes)

Comprehensive reference for Characterization (5 processes), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Charybdopsis: Peptide Toxin in Pharmacology Reference

Charybdopsis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Charybdotoxin: Peptide Toxin in Pharmacology Reference

Potassium channel blocker from scorpion venom with broad Kv channel activity. This peptide toxin is derived from venom and studied for its pharmacological ac...

Venom Peptides intermediate

Checkpoint Inhibitor 4-1BB-4-1BBL

Comprehensive reference for checkpoint inhibitor 4-1BB-4-1BBL, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor 4-1BB: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor 4-1BB, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H3-4Ig

Comprehensive reference for checkpoint inhibitor B7-H3-4Ig, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H3-antibody

Comprehensive reference for checkpoint inhibitor B7-H3-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H3: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor B7-H3, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H4-antibody

Comprehensive reference for checkpoint inhibitor B7-H4-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H4-VTCN

Comprehensive reference for checkpoint inhibitor B7-H4-VTCN, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor B7-H4: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor B7-H4, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD200-CD200R

Comprehensive reference for checkpoint inhibitor CD200-CD200R, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD200: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CD200, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD27-CD70

Comprehensive reference for checkpoint inhibitor CD27-CD70, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD27: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CD27, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD28-B7: Comprehensive Peptide Refer...

Comprehensive reference for checkpoint inhibitor CD28-B7, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD28: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CD28, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD40-CD40L

Comprehensive reference for checkpoint inhibitor CD40-CD40L, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD40: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CD40, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CD47: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CD47, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor Conjugates

Comprehensive reference for Checkpoint Inhibitor Conjugates, a peptide compound with applications in research and therapeutics.

Peptide Drug Conjugates intermediate

Checkpoint Inhibitor CTLA-4-antibody

Comprehensive reference for checkpoint inhibitor CTLA-4-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CTLA-4-B7

Comprehensive reference for checkpoint inhibitor CTLA-4-B7, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor CTLA-4: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor CTLA-4, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor FcRn-IgG: Comprehensive Peptide Refe...

Comprehensive reference for checkpoint inhibitor FcRn-IgG, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor FcRn: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor FcRn, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor ICOS-ICOSL

Comprehensive reference for checkpoint inhibitor ICOS-ICOSL, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor ICOS: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor ICOS, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor LAG-3-antibody

Comprehensive reference for checkpoint inhibitor LAG-3-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor LAG-3-MHC

Comprehensive reference for checkpoint inhibitor LAG-3-MHC, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor LAG-3: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor LAG-3, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor OX40-OX40L

Comprehensive reference for checkpoint inhibitor OX40-OX40L, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor OX40: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor OX40, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor PD-1-PD-L1

Comprehensive reference for checkpoint inhibitor PD-1-PD-L1, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor PD-1-PD-L1-antibody

Comprehensive reference for checkpoint inhibitor PD-1-PD-L1-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor PD-1: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor PD-1, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor PD-L1: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor PD-L1, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor SIRP-alpha

Comprehensive reference for checkpoint inhibitor SIRP-alpha, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor SIRP-alpha-CD47

Comprehensive reference for checkpoint inhibitor SIRP-alpha-CD47, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIGIT-antibody

Comprehensive reference for checkpoint inhibitor TIGIT-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIGIT-CD155

Comprehensive reference for checkpoint inhibitor TIGIT-CD155, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIGIT: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor TIGIT, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIM-3-antibody

Comprehensive reference for checkpoint inhibitor TIM-3-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIM-3-Galectin

Comprehensive reference for checkpoint inhibitor TIM-3-Galectin, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor TIM-3: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor TIM-3, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor VISTA-antibody

Comprehensive reference for checkpoint inhibitor VISTA-antibody, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor VISTA-B7-H1

Comprehensive reference for checkpoint inhibitor VISTA-B7-H1, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

Checkpoint Inhibitor VISTA: Comprehensive Peptide Reference

Comprehensive reference for checkpoint inhibitor VISTA, covering molecular structure, pharmacological properties, receptor interactions,

Cancer Immunotherapy intermediate

ChEMBL: Oligopeptide Research Reference

Chemical database of bioactive molecules with drug-like properties. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Chemical Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Chemical for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...

Peptide Synthesis Methods advanced

Chemiluminescent immunoassay: Comprehensive Peptide Refer...

High-throughput clinical. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Biomarkers Expanded intermediate

Chemokine CCL1: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL11: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL11, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL13: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL13, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL14: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL14, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL17: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL17, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL18: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL18, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL19: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL19, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL2: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL20: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL20, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL21: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL21, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL22: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL22, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL24: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL24, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL25: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL25, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL26: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL26, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL27: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL27, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL3: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL3, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL4: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL4, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL5: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL5, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL7: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL7, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CCL8: Oligopeptide Research Reference

Comprehensive reference for chemokine CCL8, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CX3CL1: Oligopeptide Research Reference

Comprehensive reference for chemokine CX3CL1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL1: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL10: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL10, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL11: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL11, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL12: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL12, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL13: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL13, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL14: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL14, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL16: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL16, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL17: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL17, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL2: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL3: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL3, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL5: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL5, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL6: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL6, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL8: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL8, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine CXCL9: Oligopeptide Research Reference

Comprehensive reference for chemokine CXCL9, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine XCL1: Oligopeptide Research Reference

Comprehensive reference for chemokine XCL1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Chemokine XCL2: Oligopeptide Research Reference

Comprehensive reference for chemokine XCL2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Cherry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cherry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Chi-Conotoxin TxIA: Peptide Toxin in Pharmacology Reference

Acetylcholine release inhibitor from Conus textile blocking presynaptic channels. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

Chia Peptide: Oligopeptide Research Reference

A bioactive peptide derived from chia with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Chicken Avian Beta-Defensin (General)

Comprehensive reference for Chicken Avian Beta-Defensin (General), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Chicken Calcitonin: Oligopeptide Research Reference

32-aa hormone from chicken parafollicular C-cells. Regulates calcium metabolism. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Chicken Cathelicidin-1 (CATH-1)

Comprehensive reference for Chicken Cathelicidin-1 (CATH-1), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Chicken Cathelicidin: Oligopeptide Research Reference

Chicken Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Chicken Galanin: Oligopeptide Research Reference

Galanin neuropeptide from chicken brain. Roles in feeding behavior and neuroendocrine regulation. This peptide or oligopeptide is studied for its biological ...

Peptide Therapeutics intermediate

Chicken GH: Oligopeptide Research Reference

Growth hormone from chicken pituitary. 191-aa protein regulating growth and metabolism in avian species. This peptide or oligopeptide is studied for its biol...

Peptide Therapeutics intermediate

Chicken Glucagon: Oligopeptide Research Reference

29-aa hormone from chicken pancreas. Regulates glucose metabolism. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Chicken GnRH: Oligopeptide Research Reference

Chicken GnRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Chicken Growth Hormone (cGH): Comprehensive Peptide Refer...

Comprehensive reference for Chicken Growth Hormone (cGH), a peptide compound with applications in research and therapeutics.

Peptide Hormones intermediate

Chicken Insulin: Oligopeptide Research Reference

Insulin from chicken pancreas. Highly conserved with mammalian insulin. Used in comparative endocrinology research. Covers molecular mechanisms, biological a...

Peptide Therapeutics intermediate

Chicken Lysozyme: Oligopeptide Research Reference

129-aa enzyme from chicken egg white. Hydrolyzes bacterial cell wall peptidoglycan. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Chicken Neuropeptide Y (cNPY): Comprehensive Peptide Refe...

Comprehensive reference for Chicken Neuropeptide Y (cNPY), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

Chicken NPY: Oligopeptide Research Reference

NPY from chicken brain. Regulates feeding behavior in poultry. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Chicken Ovotransferrin (Conalbumin)

Comprehensive reference for Chicken Ovotransferrin (Conalbumin), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Chicken Ovotransferrin: Oligopeptide Research Reference

686-aa iron-binding glycoprotein from chicken egg white. Antimicrobial via iron sequestration. This peptide or oligopeptide is studied for its biological act...

Peptide Therapeutics intermediate

Chicken PACAP: Oligopeptide Research Reference

Chicken PACAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Chicken Parathyroid Hormone (cPTH)

Comprehensive reference for Chicken Parathyroid Hormone (cPTH), a peptide compound with applications in research and therapeutics.

Peptide Hormones intermediate

Chicken PTH: Oligopeptide Research Reference

Parathyroid hormone from chicken parathyroid glands. Regulates calcium homeostasis in avian species. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Chicken Vasoactive Intestinal Peptide (cVIP)

Comprehensive reference for Chicken Vasoactive Intestinal Peptide (cVIP), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

Chicken VIP: Oligopeptide Research Reference

VIP from chicken intestine. Regulates GI function and vasodilation. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Chickpea Peptide: Oligopeptide Research Reference

A bioactive peptide derived from chickpea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

ChimeraX: Oligopeptide Research Reference

Molecular visualization program for macromolecular structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Chitinase Plant: Oligopeptide Research Reference

chitinase plant in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Agricultural Peptides intermediate

Chitosan Nanoparticles Oral: Comprehensive Peptide Reference

Chitosan-based nanoparticles enhancing oral peptide bioavailability through mucoadhesion. This peptide or oligopeptide is studied for its biological activity...

Drug Delivery intermediate

Chitosan Peptides: Oligopeptide Research Reference

Chitosan Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Chloroeremomycin: Antimicrobial Peptide Reference

Glycopeptide antibiotic precursor to oritavancin, produced by Amycolatopsis orientalis with activity against vancomycin-resistant organisms.

Antimicrobial Peptides advanced

Chlorotoxin: Peptide Toxin in Pharmacology Reference

Chlorotoxin is a 36-amino acid peptide from deathstalker scorpion venom that binds specifically to glioma cells and matrix metalloproteinase-2, used as a tum...

Toxin Peptides advanced

Cholecystokinin Family Peptides

Guide to CCK family peptides in digestion, satiety signaling, and neurotransmission. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Families intermediate

Cholecystokinin Receptor Pharmacology

Molecular pharmacology and clinical significance of cholecystokinin-A (CCK-A) and cholecystokinin-B (CCK-B) receptors in satiety, anxiety, and gastrointestin...

Drug Development intermediate

Cholecystokinin-8: Oligopeptide Research Reference

CCK-8 is the eight-amino acid bioactive fragment of cholecystokinin responsible for satiety signaling, pancreatic enzyme secretion, and gallbladder contraction.

Gastrointestinal Peptides intermediate

Cholecystokinin: Neuropeptide in Neuroscience Reference

A gastrointestinal neuropeptide that stimulates gallbladder contraction, pancreatic enzyme secretion, and appetite suppression, existing in multiple isoforms...

Neuropeptides intermediate

CHR-021: Oligopeptide Research Reference

Molecular weight, sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Peptide Manufacturing intermediate

CHR-022: Oligopeptide Research Reference

Composition, quantification. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Manufacturing intermediate

CHR-023: Oligopeptide Research Reference

Stereochemistry, conformation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Manufacturing intermediate

CHR-024: Oligopeptide Research Reference

Secondary structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Peptide Manufacturing intermediate

CHR-025: Oligopeptide Research Reference

3D atomic structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Peptide Manufacturing intermediate

Chromatin remodeling: Oligopeptide Research Reference

Comprehensive reference for chromatin remodeling, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Chromatographic Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Chromatographic for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

chromatography for Peptides: Comprehensive Peptide Reference

Application of chromatography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Chromogranin A (CgA): Oligopeptide Research Reference

Chromogranin A (CgA), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarker Peptides intermediate

Chromogranin A: Oligopeptide Research Reference

439-aa acidic secretory protein co-secreted with catecholamines from neurosecretory granules (chromaffin cells, enterochromaffin-like cells). Marker of neuro...

Peptide Therapeutics intermediate

Chronic Pain Peptides: Oligopeptide Research Reference

Peptides associated with Chronic Pain including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Chrysophsin 1: Oligopeptide Research Reference

Chrysophsin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Chrysophsin 2: Oligopeptide Research Reference

Chrysophsin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Chrysophsin 3: Oligopeptide Research Reference

Chrysophsin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Chrysophsin: Antimicrobial Peptide Reference

chrysophsin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Chymotrypsin Inhibitor (Barley)

Comprehensive reference for Chymotrypsin Inhibitor (Barley), a peptide compound with applications in research and therapeutics.

Plant Peptides intermediate

Ciguatoxin: Oligopeptide Research Reference

Ciguatoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Cilengitide: Oligopeptide Research Reference

Cilengitide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Cilofungin: Oligopeptide Research Reference

Cilofungin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Circular Dichroism for Peptides

Discover circular dichroism spectroscopy for analyzing peptide secondary structure and conformational changes. This peptide or oligopeptide is studied for it...

Peptide Analysis intermediate

Circular Dichroism: Oligopeptide Research Reference

Circular Dichroism, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Circular RNA: Oligopeptide Research Reference

Comprehensive reference for circular rna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Circulin A/B: Oligopeptide Research Reference

Circulin A/B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

CK-MB (Creatine Kinase-MB): Comprehensive Peptide Reference

CK-MB isoenzyme of creatine kinase. Predominantly found in cardiac muscle (~15-25% of total CK in heart). Normal: <5 ng/mL. Rises 4-6h after MI, peaks at 12-...

Peptide Therapeutics intermediate

Cleavage: Oligopeptide Research Reference

Proteolytic processing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Peptide Interactions intermediate

Click Chemistry Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Click Chemistry for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Click Chemistry: Oligopeptide Research Reference

Bioorthogonal reactions: CuAAC, SPAAC. Nobel Prize 2001. Applications: ADCs, PET imaging, PROTACs. This peptide or oligopeptide is studied for its biological...

Peptide Therapeutics intermediate

Clinical Trial Phase 1 Study 1

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 10

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 11

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 12

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 13

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 14

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 15

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 16

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 17

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 18

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 19

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 2

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 20

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 21

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 22

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 23

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 24

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 25

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 26

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 27

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 28

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 29

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 3

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 30

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 31

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 32

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 33

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 34

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 35

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 36

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 37

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 38

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 39

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 4

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 40

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 41

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 42

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 43

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 44

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 45

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 46

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 47

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 48

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 49

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 5

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 50

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 6

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 7

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 8

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 1 Study 9

A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.

Clinical Trials advanced

Clinical Trial Phase 2 Study 1

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 10

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 11

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 12

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 13

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 14

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 15

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 16

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 17

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 18

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 19

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 2

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 20

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 21

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 22

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 23

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 24

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 25

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 26

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 27

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 28

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 29

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 3

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 30

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 31

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 32

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 33

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 34

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 35

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 36

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 37

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 38

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 39

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 4

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 40

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 41

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 42

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 43

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 44

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 45

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 46

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 47

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 48

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 49

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 5

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 50

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 6

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 7

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 8

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trial Phase 2 Study 9

A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...

Clinical Trials advanced

Clinical Trials for Peptides: Comprehensive Peptide Refer...

Explore clinical trial design considerations specific to peptide therapeutics including dose-finding and endpoints. Covers molecular mechanisms, biological a...

Regulatory advanced

ClinicalTrials.gov: Oligopeptide Research Reference

NIH registry and results database of publicly and privately funded clinical studies. This peptide or oligopeptide is studied for its biological activity, str...

Clinical intermediate

CLPK: Antimicrobial Peptide Reference

CLPK is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological activ...

Antimicrobial Peptides intermediate

CLPY: Antimicrobial Peptide Reference

CLPY is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological activ...

Antimicrobial Peptides intermediate

Clt A: Oligopeptide Research Reference

Clt A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

CLV3: Oligopeptide Research Reference

CLV3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Cmv Peptides: Oligopeptide Research Reference

Peptides associated with Cmv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...

Disease-Associated Peptides intermediate

CMV Pp65 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting CMV Pp65 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

CNP 22: Endogenous Peptide Hormone Reference

CNP-22 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...

Peptide Hormones intermediate

CNP 22: Oligopeptide Research Reference

CNP 22 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Cardiovascular Peptides intermediate

CNP 53: Endogenous Peptide Hormone Reference

CNP-53 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...

Peptide Hormones intermediate

CNP Hormone: Endogenous Peptide Hormone Reference

CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CNP Peptide Hormone: Endogenous Peptide Hormone Reference

CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CNP Protein Hormone: Endogenous Peptide Hormone Reference

CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CNTF Analog: Oligopeptide Research Reference

CNTF analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Neurological Peptides intermediate

CNTF Hormone: Endogenous Peptide Hormone Reference

CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CNTF Peptide Hormone: Endogenous Peptide Hormone Reference

CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CNTF Protein Hormone: Endogenous Peptide Hormone Reference

CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CNY10: Antimicrobial Peptide Reference

CNY10 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological acti...

Antimicrobial Peptides intermediate

Coarse Grained CGenFF for Peptides

A computational method for studying peptides using Coarse Grained CGenFF. This analytical technique provides valuable insights into peptide structure, purity...

Computational Methods advanced

Coarse Grained ENM for Peptides

A computational method for studying peptides using Coarse Grained ENM. This analytical technique provides valuable insights into peptide structure, purity, a...

Computational Methods advanced

Coarse Grained for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Coarse Grained. This analytical technique provides valuable insights into peptide structure, purity, and c...

Computational Methods advanced

Coarse Grained MD for Peptides

A computational method for studying peptides using Coarse Grained MD. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Coarse Grained SIRAH for Peptides

A computational method for studying peptides using Coarse Grained SIRAH. This analytical technique provides valuable insights into peptide structure, purity,...

Computational Methods advanced

Coated Microneedle Peptide: Comprehensive Peptide Reference

Solid microneedles coated with peptide formulations for skin delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Drug Delivery intermediate

Coating Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Coating for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...

Peptide Synthesis Methods advanced

Cobratoxin Alpha: Peptide Toxin in Pharmacology Reference

cobratoxin-alpha is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmaco...

Venom Peptides intermediate

Cobratoxin Beta: Peptide Toxin in Pharmacology Reference

cobratoxin-beta is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacol...

Venom Peptides intermediate

Coconut Peptide: Oligopeptide Research Reference

A bioactive peptide derived from coconut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Codorphin: Neuropeptide in Neuroscience Reference

codorphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Coil Assembly System 1: Oligopeptide Research Reference

A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Coil Assembly System 2: Oligopeptide Research Reference

A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Coil Assembly System 3: Oligopeptide Research Reference

A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

ColabFold for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using ColabFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

Colistimethate: Oligopeptide Research Reference

Colistimethate, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Colistin: Antimicrobial Peptide Reference

Polymyxin lipopeptide antibiotic that disrupts gram-negative bacterial outer membranes, used as last-line therapy for MDR infections.

Antimicrobial Peptides advanced

Colistin: Oligopeptide Research Reference

Cyclic lipopeptide Polymyxin E for extensively drug-resistant gram-negative infections. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Drugs intermediate

Collagen Binding Purification: Comprehensive Peptide Refe...

A purification technique for separating and isolating peptides using Collagen Binding. This analytical technique provides valuable insights into peptide stru...

Purification Methods advanced

Collagen Elastin Copolymer: Comprehensive Peptide Reference

collagen elastin copolymer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Structural Peptides intermediate

Collagen Peptides (Marine): Comprehensive Peptide Reference

Comprehensive reference for Collagen Peptides (Marine), a peptide compound with applications in research and therapeutics.

Marine Peptides intermediate

Collagen tripeptide: Structure, Function, and Significance

Gly-Pro-Hyp is the most abundant tripeptide repeat in collagen. It is essential for the triple helix stability and is used as a bioactive supplement.

Structural Peptides intermediate

Collagen Triple Helix (Gly-X-Y Repeats)

Comprehensive reference for Collagen Triple Helix (Gly-X-Y Repeats), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Collagen triple helix: Oligopeptide Research Reference

Comprehensive reference for collagen triple helix, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Collagenase Inhibitor: Enzyme in Peptide Biology Reference

collagenase inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate s...

Enzyme Peptides intermediate

Collaxyl: Oligopeptide Research Reference

Palmitoyl tripeptide-1 + tetrapeptide-7. Stimulates collagen. Anti-aging skincare. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

colloid for Peptides: Analytical Technique in Peptide Res...

Application of colloid technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...

Structural Biology Techniques advanced

Colony Stimulating Factor EPO-1-100

Comprehensive reference for colony stimulating factor EPO-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor EPO-1-165

Comprehensive reference for colony stimulating factor EPO-1-165, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor EPO-1-50

Comprehensive reference for colony stimulating factor EPO-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor Flt3L-1-100

Comprehensive reference for colony stimulating factor Flt3L-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor Flt3L-1-150

Comprehensive reference for colony stimulating factor Flt3L-1-150, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor Flt3L-1-220

Comprehensive reference for colony stimulating factor Flt3L-1-220, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor G-CSF-1-100

Comprehensive reference for colony stimulating factor G-CSF-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor G-CSF-1-174

Comprehensive reference for colony stimulating factor G-CSF-1-174, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor G-CSF-1-50

Comprehensive reference for colony stimulating factor G-CSF-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor GM-CSF-1-127

Comprehensive reference for colony stimulating factor GM-CSF-1-127, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor GM-CSF-1-50

Comprehensive reference for colony stimulating factor GM-CSF-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor GM-CSF-1-80

Comprehensive reference for colony stimulating factor GM-CSF-1-80, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor M-CSF-1-100

Comprehensive reference for colony stimulating factor M-CSF-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor M-CSF-1-150

Comprehensive reference for colony stimulating factor M-CSF-1-150, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor M-CSF-1-223

Comprehensive reference for colony stimulating factor M-CSF-1-223, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor SCF-1-100

Comprehensive reference for colony stimulating factor SCF-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor SCF-1-165

Comprehensive reference for colony stimulating factor SCF-1-165, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor SCF-1-50

Comprehensive reference for colony stimulating factor SCF-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor TPO-1-100

Comprehensive reference for colony stimulating factor TPO-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor TPO-1-150

Comprehensive reference for colony stimulating factor TPO-1-150, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor TPO-1-200

Comprehensive reference for colony stimulating factor TPO-1-200, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor TPO-1-332

Comprehensive reference for colony stimulating factor TPO-1-332, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colony Stimulating Factor TPO-1-50

Comprehensive reference for colony stimulating factor TPO-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Colorectal Cancer Peptides: Comprehensive Peptide Reference

Peptides associated with Colorectal Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...

Disease-Associated Peptides intermediate

Colorectal Cancer: Oligopeptide Research Reference

Malignant transformation of colonic or rectal epithelium. Molecular pathways: APC/β-catenin (60%), KRAS (40%), MSI (15%). Treatments: surgery, FOLFOX/FOLFIRI...

Peptide Therapeutics intermediate

Companion Diagnostics: Oligopeptide Research Reference

Peptide-based companion diagnostics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Therapeutics intermediate

Complement C3 Inhibitor: Oligopeptide Research Reference

complement C3 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Immune Peptides intermediate

Complement C3a Antimicrobial: Comprehensive Peptide Refer...

Anaphylatoxin C3a with direct antimicrobial activity against gram-positive and negative bacteria. This antimicrobial peptide demonstrates activity against pa...

Antimicrobial Peptides advanced

Complement C5 Inhibitor: Oligopeptide Research Reference

complement C5 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Immune Peptides intermediate

Complement C5a Antimicrobial: Comprehensive Peptide Refer...

Potent anaphylatoxin with immunomodulatory and direct antimicrobial functions. This antimicrobial peptide demonstrates activity against pathogens and is stud...

Antimicrobial Peptides advanced

Complement Inhibitor C3-inhibitor-1

Comprehensive reference for complement inhibitor C3-inhibitor-1, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-10

Comprehensive reference for complement inhibitor C3-inhibitor-10, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-11

Comprehensive reference for complement inhibitor C3-inhibitor-11, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-12

Comprehensive reference for complement inhibitor C3-inhibitor-12, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-13

Comprehensive reference for complement inhibitor C3-inhibitor-13, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-14

Comprehensive reference for complement inhibitor C3-inhibitor-14, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-15

Comprehensive reference for complement inhibitor C3-inhibitor-15, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-16

Comprehensive reference for complement inhibitor C3-inhibitor-16, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-17

Comprehensive reference for complement inhibitor C3-inhibitor-17, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-18

Comprehensive reference for complement inhibitor C3-inhibitor-18, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-19

Comprehensive reference for complement inhibitor C3-inhibitor-19, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-2

Comprehensive reference for complement inhibitor C3-inhibitor-2, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-20

Comprehensive reference for complement inhibitor C3-inhibitor-20, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-21

Comprehensive reference for complement inhibitor C3-inhibitor-21, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-22

Comprehensive reference for complement inhibitor C3-inhibitor-22, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-23

Comprehensive reference for complement inhibitor C3-inhibitor-23, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-24

Comprehensive reference for complement inhibitor C3-inhibitor-24, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-25

Comprehensive reference for complement inhibitor C3-inhibitor-25, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-26

Comprehensive reference for complement inhibitor C3-inhibitor-26, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-27

Comprehensive reference for complement inhibitor C3-inhibitor-27, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-28

Comprehensive reference for complement inhibitor C3-inhibitor-28, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-29

Comprehensive reference for complement inhibitor C3-inhibitor-29, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-3

Comprehensive reference for complement inhibitor C3-inhibitor-3, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-30

Comprehensive reference for complement inhibitor C3-inhibitor-30, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-31

Comprehensive reference for complement inhibitor C3-inhibitor-31, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-32

Comprehensive reference for complement inhibitor C3-inhibitor-32, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-33

Comprehensive reference for complement inhibitor C3-inhibitor-33, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-34

Comprehensive reference for complement inhibitor C3-inhibitor-34, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-35

Comprehensive reference for complement inhibitor C3-inhibitor-35, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-36

Comprehensive reference for complement inhibitor C3-inhibitor-36, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-37

Comprehensive reference for complement inhibitor C3-inhibitor-37, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-38

Comprehensive reference for complement inhibitor C3-inhibitor-38, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-39

Comprehensive reference for complement inhibitor C3-inhibitor-39, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-4

Comprehensive reference for complement inhibitor C3-inhibitor-4, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-40

Comprehensive reference for complement inhibitor C3-inhibitor-40, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-5

Comprehensive reference for complement inhibitor C3-inhibitor-5, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-6

Comprehensive reference for complement inhibitor C3-inhibitor-6, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-7

Comprehensive reference for complement inhibitor C3-inhibitor-7, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-8

Comprehensive reference for complement inhibitor C3-inhibitor-8, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Complement Inhibitor C3-inhibitor-9

Comprehensive reference for complement inhibitor C3-inhibitor-9, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

complete-response Resource: Comprehensive Peptide Reference

The complete-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

composite-endpoint Resource: Comprehensive Peptide Reference

The composite-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Computational Design: Oligopeptide Research Reference

AI and computational approaches to peptide design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Therapeutics intermediate

Computational Technologies: Comprehensive Peptide Reference

In silico methods for peptide design and prediction. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...

Peptide Technologies intermediate

Computational Technology Comparison

Comparison of computational tools for peptide design and analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Con-Insulin G1: Peptide Toxin in Pharmacology Reference

Evolutionary modified insulin from Conus geographus with novel receptor selectivity. This peptide toxin is derived from venom and studied for its pharmacolog...

Venom Peptides advanced

Conantokin G: Peptide Toxin in Pharmacology Reference

NMDA receptor antagonist from Conus geographus with anticonvulsant properties. This peptide toxin is derived from venom and studied for its pharmacological a...

Venom Peptides intermediate

Conantokin T: Peptide Toxin in Pharmacology Reference

NMDA receptor antagonist from Conus tulipa with selective NR2B subunit binding. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

Concentrated Insulin U500: Comprehensive Peptide Reference

Five-fold concentrated regular insulin for insulin-resistant patients requiring high doses. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs intermediate

Cone Snail Drug Discovery: Comprehensive Peptide Reference

Cone snail venom as source of novel therapeutics including ziconotide. This peptide toxin is derived from venom and studied for its pharmacological activity,...

Venom Peptides intermediate

Cone Snail Venoms: Peptide Toxin in Pharmacology Reference

Cav, Nav, nAChR, K+, NET. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applicati...

Venom Peptides intermediate

Cone snail: Peptide Toxin in Pharmacology Reference

~0.01 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...

Toxin Peptides intermediate

Cone Venom Analgesic Peptides: Comprehensive Peptide Refe...

Conotoxins with potent analgesic activity for chronic pain treatment. This peptide toxin is derived from venom and studied for its pharmacological activity, ...

Venom Peptides intermediate

Cone Venom Pain Targets: Peptide Toxin in Pharmacology Re...

Molecular targets of conotoxins in pain pathways. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action,...

Venom Peptides intermediate

Confocal Microscopy for Peptides

Learn confocal fluorescence microscopy techniques for visualizing peptide localization in cells and tissues. This peptide or oligopeptide is studied for its ...

Peptide Analysis intermediate

Coninsulin S: Peptide Toxin in Pharmacology Reference

Insulin-like peptide from Conus striatus venom causing hypoglycemic shock in prey. This peptide toxin is derived from venom and studied for its pharmacologic...

Venom Peptides advanced

Conopressin G: Peptide Toxin in Pharmacology Reference

conopressin-G is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for it...

Venom Peptides intermediate

Conopressin S: Peptide Toxin in Pharmacology Reference

conopressin-S is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for it...

Venom Peptides intermediate

Conorfamide: Oligopeptide Research Reference

Conorfamide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Conotoxin (Generic): Peptide Toxin in Pharmacology Reference

Conotoxin (Generic), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Conotoxin Analgesic Pipeline: Comprehensive Peptide Refer...

Clinical pipeline of next-generation conotoxin analgesics. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...

Venom Peptides intermediate

Conotoxin Folding Protocols: Comprehensive Peptide Reference

Oxidative folding strategies for conotoxin disulfide bond formation. This peptide toxin is derived from venom and studied for its pharmacological activity, m...

Venom Peptides advanced

Conotoxin gviiia: Structure, Function, and Significance

Omega-conotoxin GVIIIA is a potent N-type calcium channel blocker from cone snail venom, used as a research tool for studying pain pathways.

Venom Peptides intermediate

Conotoxin mriia: Structure, Function, and Significance

Ziconotide (Prialt) is derived from omega-conotoxin MVIIA. It is an FDA-approved non-opioid analgesic for severe chronic pain.

Venom Peptides intermediate

Conotoxin MVIIA: Oligopeptide Research Reference

Omega-conotoxin from Conus magus that blocks N-type calcium channels, used as an intrathecal analgesic for severe chronic pain.

Marine Peptides advanced

Conotoxin research, calcium channel pharmacology

Conotoxin research, calcium channel pharmacology is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

contact-map Resource: Oligopeptide Research Reference

The contact-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Container Closure for Peptides

Learn container closure system requirements for peptide drug products including extractables and leachables testing. Covers molecular mechanisms, biological ...

Regulatory advanced

Contignacin: Peptide Toxin in Pharmacology Reference

contignacin is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for its ...

Venom Peptides intermediate

Continuous Manufacturing: Oligopeptide Research Reference

Continuous production processes for peptides. More efficient than batch processing. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Continuous Subcutaneous Insulin Infusion

Technology and clinical principles of insulin pump therapy providing continuous basal rates and programmable bolus dosing.

Insulin Family intermediate

Contulakin-G: Oligopeptide Research Reference

Contulakin-G, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Copd Peptides: Oligopeptide Research Reference

Peptides associated with Copd including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...

Disease-Associated Peptides intermediate

Corazonin: Oligopeptide Research Reference

Corazonin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Cordycepin: Oligopeptide Research Reference

Cordycepin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Corn Peptide: Oligopeptide Research Reference

A bioactive peptide derived from corn with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Corn Zein Peptide: Oligopeptide Research Reference

corn zein peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Food-Derived Peptides intermediate

Corticotropin-Releasing Hormone

A 41-amino acid hypothalamic neuropeptide that initiates the stress response by stimulating ACTH release from the anterior pituitary, activating the HPA axis.

Neuropeptides intermediate

Cortisol Hormone: Endogenous Peptide Hormone Reference

Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Cortisol Peptide Hormone: Endogenous Peptide Hormone Refe...

Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Cortisol Protein Hormone: Endogenous Peptide Hormone Refe...

Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Cortistatin: Oligopeptide Research Reference

cortistatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Anti-inflammatory Peptides intermediate

Cosmetic Peptide Market: Oligopeptide Research Reference

Market analysis for cosmetic peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Peptide Therapeutics intermediate

Cosmetic Synthetic: Oligopeptide Research Reference

Peptides for topical applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Synthetic Peptides intermediate

Cosmetic: Oligopeptide Research Reference

Cosmetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity,...

Peptide Applications intermediate

Coursera Peptide Chemistry: Comprehensive Peptide Reference

Online course on peptide chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Peptide Therapeutics intermediate

Covid 19 Peptides: Oligopeptide Research Reference

Peptides associated with Covid 19 including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

COVID-19: Oligopeptide Research Reference

SARS-CoV-2 respiratory illness. Treatments: antivirals, monoclonal antibodies, corticosteroids. This peptide or oligopeptide is studied for its biological ac...

Peptide Therapeutics intermediate

CPF: Antimicrobial Peptide Reference

CPF, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

CpTx1: Peptide Toxin in Pharmacology Reference

CpTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...

Venom Peptides intermediate

Crabrolin (Vespa): Oligopeptide Research Reference

Crabrolin (Vespa), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Crabrolin: Peptide Toxin in Pharmacology Reference

Crabrolin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Cranberry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cranberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

CRH (Corticotropin-releasing hormone)

Comprehensive reference for CRH (Corticotropin-releasing hormone), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

CRH Hormone: Endogenous Peptide Hormone Reference

CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CRH Peptide Hormone: Endogenous Peptide Hormone Reference

CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

CRH Protein Hormone: Endogenous Peptide Hormone Reference

CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

Crimean Congo N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Crimean Congo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Vaccines advanced

Crocodilian Antimicrobial Serum Proteins

Comprehensive reference for Crocodilian Antimicrobial Serum Proteins, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Crocodilian Cathelicidin: Oligopeptide Research Reference

Comprehensive reference for Crocodilian Cathelicidin, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Crocodilian Defensin: Oligopeptide Research Reference

Crocodilian Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Crocodilian Peptides: Oligopeptide Research Reference

Antimicrobial, Anti-infective. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Reptile Peptides intermediate

Crocodilian Serum Proteins: Comprehensive Peptide Reference

Comprehensive reference for Crocodilian Serum Proteins, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Crocodilin: Oligopeptide Research Reference

Crocodilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Crohns Peptides: Oligopeptide Research Reference

Peptides associated with Crohns including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Crop Milk Peptides: Oligopeptide Research Reference

Crop Milk Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Crop Protection: Oligopeptide Research Reference

Use of antimicrobial peptides as biopesticides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Peptide Therapeutics intermediate

Cross Attention for Peptides: Comprehensive Peptide Refer...

A computational method for studying peptides using Cross Attention. This analytical technique provides valuable insights into peptide structure, purity, and ...

Computational Methods advanced

Cross-Cutting Themes: Oligopeptide Research Reference

Common themes across peptide-related diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

Cross-Linking MS for Peptides: Comprehensive Peptide Refe...

Understand chemical cross-linking mass spectrometry for mapping peptide-protein interaction interfaces. This peptide or oligopeptide is studied for its biolo...

Peptide Analysis advanced

Cross-Reactive Antibodies: Comprehensive Peptide Reference

Antibodies that cross-react between therapeutic peptides and endogenous proteins. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Crotamine: Peptide Toxin in Pharmacology Reference

Crotamine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

CRP (C-Reactive Protein): Oligopeptide Research Reference

Comprehensive reference for CRP (C-Reactive Protein), a peptide compound with applications in research and therapeutics.

Inflammatory intermediate

Cryo EM SPA Analysis: Analytical Technique in Peptide Res...

An analytical technique for characterizing peptides using Cryo EM SPA. This analytical technique provides valuable insights into peptide structure, purity, a...

Analytical Techniques advanced

Cryo ET Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using Cryo ET. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

Cryo-Electron Microscopy: Oligopeptide Research Reference

Cryo-EM for determining peptide and protein structures at near-atomic resolution. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

cryo-EM for Peptides: Analytical Technique in Peptide Res...

Application of cryo-EM technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...

Structural Biology Techniques advanced

Cryo-EM for Peptides: Analytical Technique in Peptide Res...

Learn how cryo-electron microscopy enables near-atomic resolution imaging of peptide assemblies and complexes. This peptide or oligopeptide is studied for it...

Peptide Analysis advanced

Cryptdin 1: Antimicrobial Peptide Reference

cryptdin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...

Antimicrobial Peptides intermediate

Cryptdin 2: Antimicrobial Peptide Reference

cryptdin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...

Antimicrobial Peptides intermediate

Cryptdin 3: Antimicrobial Peptide Reference

cryptdin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...

Antimicrobial Peptides intermediate

Cryptdin 4: Antimicrobial Peptide Reference

cryptdin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...

Antimicrobial Peptides intermediate

Crystalline Insulin Formulations

Use of zinc-insulin crystallization to create depot formulations providing extended insulin release. This peptide or oligopeptide is studied for its biologic...

Insulin Family advanced

Crystalline Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using Crystalline for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

Crystallization: Oligopeptide Research Reference

Crystallization, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

crystallography for Peptides: Comprehensive Peptide Refer...

Application of crystallography technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...

Structural Biology Techniques advanced

Css II (CssIV): Peptide Toxin in Pharmacology Reference

Css II (CssIV), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Css II: Peptide Toxin in Pharmacology Reference

Css II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

CSTX-1: Peptide Toxin in Pharmacology Reference

CSTX-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

CT 1 Hormone: Endogenous Peptide Hormone Reference

CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CT 1 Peptide Hormone: Endogenous Peptide Hormone Reference

CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CT 1 Protein Hormone: Endogenous Peptide Hormone Reference

CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

CTLA 4 Blocker: Oligopeptide Research Reference

CTLA 4 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Immune Peptides intermediate

Cucumber Peptide: Oligopeptide Research Reference

A bioactive peptide derived from cucumber with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

Curculin: Oligopeptide Research Reference

curculin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Agricultural Peptides intermediate

Curcumin Peptide: Oligopeptide Research Reference

curcumin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Antioxidant Peptides intermediate

Cutoff Value Interpretation: Comprehensive Peptide Reference

Comprehensive reference for Cutoff Value Interpretation, a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Cyanogen Bromide Purification: Comprehensive Peptide Refe...

A purification technique for separating and isolating peptides using Cyanogen Bromide. This analytical technique provides valuable insights into peptide stru...

Purification Methods advanced

Cyclic Peptide-Peptoid Hybrids

Chimeric molecules combining cyclic peptide and peptoid elements for enhanced proteolytic stability and cell penetration.

Therapeutic Peptides advanced

Cyclic peptide: Oligopeptide Research Reference

Comprehensive reference for cyclic peptide, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Cyclic Peptides in Drug Discovery

Structural and pharmacological principles of cyclic peptide drug design including head-to-tail cyclization, stapled peptides, and strategies for enhanced cel...

Drug Development intermediate

Cyclic Peptides: Oligopeptide Research Reference

Cyclized peptides for enhanced stability. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Synthetic Peptides intermediate

Cyclic System 1: Oligopeptide Research Reference

A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

Cyclic System 2: Oligopeptide Research Reference

A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

Cyclic System 3: Oligopeptide Research Reference

A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

Cyclization System 1: Oligopeptide Research Reference

A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Cyclization System 2: Oligopeptide Research Reference

A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Cyclization System 3: Oligopeptide Research Reference

A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Cyclization: Post-Translational Modification Reference

5–20x. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therapeut...

Peptide Modifications intermediate

Cyclodextrin Peptide Complex: Comprehensive Peptide Refer...

Cyclodextrin inclusion complexes improving peptide stability and solubility. This peptide or oligopeptide is studied for its biological activity, structure-a...

Drug Delivery intermediate

Cyclophilin discovery, calcineurin pathway

Cyclophilin discovery, calcineurin pathway is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Cyclopsychotride A: Oligopeptide Research Reference

cyclopsychotride-A is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.

Plant Peptides intermediate

Cyclosporin A: Oligopeptide Research Reference

Cyclosporin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Cyclosporine: Oligopeptide Research Reference

Cyclic undecapeptide calcineurin inhibitor for immunosuppression in transplantation. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Drugs intermediate

Cyclosporine: Oligopeptide Research Reference

cyclosporine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Cyclotides: Oligopeptide Research Reference

Cyclotides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Cycloviolacin O2: Oligopeptide Research Reference

Cycloviolacin O2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Cystatin C: Oligopeptide Research Reference

cystatin C in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Diagnostic Peptides intermediate

Cysteine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Cysteine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...

Amino Acid Metabolism intermediate

Cysteine Modification: Post-Translational Modification Re...

Post-translational modifications of Cysteine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...

Amino Acid Modifications intermediate

Cysteine Peptide: Oligopeptide Research Reference

Cysteine (C) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...

Amino Acid Peptides beginner

Cysteine protease degrades ECM and immunoglobulins

Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Protist Peptides intermediate

Cystic Fibrosis Peptides: Oligopeptide Research Reference

Peptides associated with Cystic Fibrosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...

Disease-Associated Peptides intermediate

CyTOF Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using CyTOF. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

Cytokine Conjugates: Oligopeptide Research Reference

Cytokine Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

Cytoskeleton dynamics: Oligopeptide Research Reference

Comprehensive reference for cytoskeleton dynamics, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Cytotoxic / Microtubule Inhibitor

Cytotoxic / Microtubule Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Peptide Drug Conjugates intermediate

Cytotoxic / Topoisomerase Inhibitor

Cytotoxic / Topoisomerase Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Peptide Drug Conjugates intermediate

D-Amino Acid Substitution: Comprehensive Peptide Reference

Replacement of L-amino acids with D-enantiomers. Increases proteolytic resistance. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

D-dimer: Oligopeptide Research Reference

Fibrin degradation product formed when plasmin cleaves cross-linked fibrin. Marker of fibrinolysis. Normal: <500 ng/mL (age-adjusted). Elevated in DVT, PE, D...

Peptide Therapeutics intermediate

Daclizumab: Oligopeptide Research Reference

Humanized anti-CD25 antibody for transplant rejection prevention and multiple sclerosis (withdrawn due to safety concerns).

Transplant Peptides intermediate

Dactinomycin (Actinomycin D): Comprehensive Peptide Refer...

Polyketide-peptide antitumor antibiotic that intercalates DNA and inhibits transcription, used for childhood cancers. Covers molecular mechanisms, biological...

Anticancer Peptides advanced

Dactinomycin: Oligopeptide Research Reference

Chromopeptide antibiotic that intercalates into DNA and inhibits RNA polymerase, used as a chemotherapeutic agent for pediatric and testicular cancers.

Anticancer Peptides advanced

DADLE: Neuropeptide in Neuroscience Reference

Synthetic delta-opioid selective enkephalin analog with neuroprotective effects. This neuropeptide is involved in neurological signaling and is studied for i...

Neuropeptides intermediate

Dalbavancin: Antimicrobial Peptide Reference

Lipoglycopeptide antibiotic with ultra-long half-life enabling single-dose treatment of acute bacterial skin infections.

Antimicrobial Peptides intermediate

DALI Resource: Oligopeptide Research Reference

The DALI database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

Dalteparin: Oligopeptide Research Reference

dalteparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Danuglipron: Oligopeptide Research Reference

Danuglipron, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Daptomycin: Antimicrobial Peptide Reference

Lipopeptide antibiotic from Streptomyces roseosporus that inserts into gram-positive bacterial membranes causing rapid depolarization.

Antimicrobial Peptides advanced

Daptomycin: Antimicrobial Peptide Reference

Cyclic lipopeptide antibiotic that inserts into gram-positive bacterial membranes, causing rapid depolarization and cell death.

Antimicrobial Peptides advanced

Daptomycin: Oligopeptide Research Reference

Cyclic lipopeptide antibiotic disrupting bacterial membrane potential for serious infections. This peptide or oligopeptide is studied for its biological acti...

Peptide Drugs intermediate

Darbepoetin Alfa: Oligopeptide Research Reference

Long-acting erythropoiesis-stimulating glycoprotein with additional sialic acid residues for extended half-life in anemia treatment.

Hematopoietic Peptides intermediate

Datopotamab Deruxtecan: Oligopeptide Research Reference

Datopotamab Deruxtecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

DBCO Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using DBCO. This analytical technique provides valuable insights into peptide structure, purit...

Purification Methods advanced

DCGSCWAFSAIGN: Oligopeptide Research Reference

Trypanosoma cruzi. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...

Protist Peptides intermediate

De Novo Peptide Design with AI

Using artificial intelligence to design novel peptide sequences from scratch. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Future advanced

Deacetylase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Deacetylase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide-Drug Conjugates advanced

Deep Learning: Oligopeptide Research Reference

High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Deep Vein Thrombosis: Oligopeptide Research Reference

Deep Vein Thrombosis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Cardiovascular intermediate

Defensin A (Phormia): Oligopeptide Research Reference

Defensin A (Phormia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Defensin B (Phormia): Oligopeptide Research Reference

Defensin B (Phormia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Defensin Gene Regulation: Antimicrobial Peptide Reference

Transcriptional regulation by NF-kB, TLR signaling, and microbial products. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides advanced

Defensin human alpha: Structure, Function, and Significance

Human alpha-defensins (HNP1-4) are 29-30 residue antimicrobial peptides stored in neutrophil azurophilic granules. They form pores in microbial membranes.

Antimicrobial Peptides intermediate

Defensin in Atopic Dermatitis: Comprehensive Peptide Refe...

Altered AMP expression in atopic dermatitis contributing to recurrent skin infections. This antimicrobial peptide demonstrates activity against pathogens and...

Antimicrobial Peptides intermediate

Defensin in Chronic Wounds: Comprehensive Peptide Reference

Altered defensin expression in chronic wounds and potential AMP supplementation therapy. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Defensin in Cystic Fibrosis: Comprehensive Peptide Reference

Defective AMP function in CF airways contributing to chronic bacterial infections. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides advanced

Defensin in IBD: Antimicrobial Peptide Reference

Altered Paneth cell defensin expression in Crohn disease affecting intestinal barrier. This antimicrobial peptide demonstrates activity against pathogens and...

Antimicrobial Peptides advanced

Defensin Medical Device Coatings

Surface coatings with defensin peptides for infection prevention on medical devices. This antimicrobial peptide demonstrates activity against pathogens and i...

Antimicrobial Peptides advanced

Defensin Microbiome Interaction

Role of defensins in shaping commensal microbiome and preventing pathogen colonization. This antimicrobial peptide demonstrates activity against pathogens an...

Antimicrobial Peptides advanced

Defensin Rs1: Antimicrobial Peptide Reference

defensin-rs1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Defensin Rs2: Antimicrobial Peptide Reference

defensin-rs2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Defensin Rs3: Antimicrobial Peptide Reference

defensin-rs3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Defensin Rs4: Antimicrobial Peptide Reference

defensin-rs4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Defensin Structural Motif: Comprehensive Peptide Reference

Six-cysteine disulfide framework defining alpha and beta defensin families. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides advanced

Defensin: Oligopeptide Research Reference

Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Degarelix - CS21 (NCT00106437)

Clinical trial of degarelix for prostate cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

Degarelix: Oligopeptide Research Reference

GnRH receptor antagonist for prostate cancer providing immediate androgen deprivation. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Drugs intermediate

Degludec Pharmacodynamics: Comprehensive Peptide Reference

Pharmacodynamic profile demonstrating flat glucose-lowering effect with intra-individual variability below 20%. Covers molecular mechanisms, biological activ...

Peptide Drugs advanced

Degludec-Aspart Coformulation: Comprehensive Peptide Refe...

Co-formulation combining ultra-long-acting degludec with rapid-acting aspart for flexible basal-bolus coverage. Covers molecular mechanisms, biological activ...

Peptide Drugs intermediate

Delivery Platforms: Oligopeptide Research Reference

Delivery Platforms, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Patents intermediate

Delivery Technologies: Oligopeptide Research Reference

Systems for peptide administration and transport. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Technologies intermediate

Delivery Technology Comparison

Comparison of different peptide delivery technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...

Peptide Therapeutics intermediate

Delta Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...

delta-conotoxin-GVIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Delta-Conotoxin PVIA: Peptide Toxin in Pharmacology Refer...

Sodium channel modulator from Conus pennaceus affecting action potential kinetics. This peptide toxin is derived from venom and studied for its pharmacologic...

Venom Peptides intermediate

Deltorphin A: Antimicrobial Peptide Reference

Deltorphin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Deltorphin B: Antimicrobial Peptide Reference

Deltorphin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Deltorphin C: Antimicrobial Peptide Reference

Deltorphin C, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Deltorphin D: Antimicrobial Peptide Reference

Deltorphin D, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Deltorphin I: Neuropeptide in Neuroscience Reference

deltorphin-I is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Deltorphin II: Neuropeptide in Neuroscience Reference

deltorphin-II is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Demeclocycline: Endogenous Peptide Hormone Reference

demeclocycline is an analog or modulator of oxytocin signaling used in obstetric and other clinical applications. Covers molecular mechanisms, biological act...

Peptide Hormones intermediate

Dendrimer encapsulation: Oligopeptide Research Reference

Comprehensive reference for dendrimer encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Dendrimer System 1: Oligopeptide Research Reference

A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendrimer System 2: Oligopeptide Research Reference

A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendrimer System 3: Oligopeptide Research Reference

A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendritic peptide: Oligopeptide Research Reference

Comprehensive reference for dendritic peptide, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Dendritic System 1: Oligopeptide Research Reference

A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendritic System 2: Oligopeptide Research Reference

A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendritic System 3: Oligopeptide Research Reference

A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Dendroaspis Natriuretic: Endogenous Peptide Hormone Refer...

Dendroaspis-natriuretic is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.

Peptide Hormones intermediate

Dendrotoxin I: Peptide Toxin in Pharmacology Reference

dendrotoxin-I is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...

Venom Peptides intermediate

Dendrotoxin K: Peptide Toxin in Pharmacology Reference

dendrotoxin-K is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...

Venom Peptides intermediate

Dendrotoxin M: Peptide Toxin in Pharmacology Reference

dendrotoxin-M is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...

Venom Peptides intermediate

Dendrotoxin: Oligopeptide Research Reference

Dendrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Dengue E Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Dengue E for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Dengue NS1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Dengue NS1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide Vaccines advanced

Dengue Peptides: Oligopeptide Research Reference

Peptides associated with Dengue including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Denosumab: Oligopeptide Research Reference

RANKL inhibitor monoclonal antibody preventing osteoclast formation for bone density improvement. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs intermediate

Density Functional for Peptides

A computational method for studying peptides using Density Functional. This analytical technique provides valuable insights into peptide structure, purity, a...

Computational Methods advanced

Deoxyribozyme: Oligopeptide Research Reference

Comprehensive reference for deoxyribozyme, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Depot injection: Oligopeptide Research Reference

Comprehensive reference for depot injection, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Depot System 1: Oligopeptide Research Reference

A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Depot System 2: Oligopeptide Research Reference

A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Depot System 3: Oligopeptide Research Reference

A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Depression and Peptides: Oligopeptide Research Reference

Explore neuropeptide systems in depression including oxytocin, vasopressin, and melanocortin-based therapies. This peptide or oligopeptide is studied for its...

Peptide Therapeutics advanced

Depression Peptides: Oligopeptide Research Reference

Peptides associated with Depression including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Depression: Oligopeptide Research Reference

Major depressive disorder (MDD) characterized by persistent depressed mood or anhedonia for ≥2 weeks, plus ≥4 additional symptoms (weight change, sleep distu...

Peptide Therapeutics intermediate

Depsipeptide Chemistry: Oligopeptide Research Reference

Chemistry and pharmacology of depsipeptides containing both amide and ester bonds, including natural products and drug candidates.

Therapeutic Peptides advanced

Dermaseptin B2: Antimicrobial Peptide Reference

Potent frog AMP selective against Candida albicans and cancer cells. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...

Antimicrobial Peptides intermediate

Dermaseptin S1: Antimicrobial Peptide Reference

dermaseptin-s1 is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...

Antimicrobial Peptides intermediate

Dermaseptin: Antimicrobial Peptide Reference

Amphipathic alpha-helical AMP from frog skin active against protozoa and bacteria. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides intermediate

Dermcidin: Antimicrobial Peptide Reference

Sweat gland-derived antimicrobial peptide providing constitutive skin surface defense. This antimicrobial peptide demonstrates activity against pathogens and...

Antimicrobial Peptides intermediate

Dermorphin: Antimicrobial Peptide Reference

Dermorphin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

DESI MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using DESI MS. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

Desirudin: Oligopeptide Research Reference

Recombinant hirudin variant for DVT prophylaxis after hip replacement surgery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Drugs intermediate

Desirudin: Oligopeptide Research Reference

desirudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Deslorelin: Oligopeptide Research Reference

Ultra-potent GnRH agonist with D-Trp6 modification primarily for veterinary use. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Drugs beginner

Desmin intermediate filament: Comprehensive Peptide Refer...

Comprehensive reference for desmin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Desmopressin: Oligopeptide Research Reference

Vasopressin analog. FDA-approved for DI, nocturnal enuresis, hemophilia. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Therapeutics intermediate

Desmopressin: Oligopeptide Research Reference

desmopressin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Destruxin: Oligopeptide Research Reference

Destruxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

DHEA Hormone: Endogenous Peptide Hormone Reference

DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

DHEA Peptide Hormone: Endogenous Peptide Hormone Reference

DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

DHEA Protein Hormone: Endogenous Peptide Hormone Reference

DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

Diabetes and Peptides: Oligopeptide Research Reference

Discover peptide-based therapies for diabetes management including GLP-1 analogs and insulin derivatives. This peptide or oligopeptide is studied for its bio...

Peptide Therapeutics beginner

Diabetes Peptides: Oligopeptide Research Reference

Peptides associated with Diabetes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Diabetes Treatment: Oligopeptide Research Reference

Peptide therapeutics for diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Therapeutics intermediate

Diabody System 1: Oligopeptide Research Reference

A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Diabody System 2: Oligopeptide Research Reference

A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Diabody System 3: Oligopeptide Research Reference

A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Diabody: Oligopeptide Research Reference

Comprehensive reference for diabody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Diafiltration Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Diafiltration. This analytical technique provides valuable insights into peptide structu...

Purification Methods advanced

Diagnostic / PET Imaging: Oligopeptide Research Reference

Diagnostic / PET Imaging is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Peptide Drug Conjugates intermediate

Diagnostic Synthetic: Oligopeptide Research Reference

Radiolabeled peptide imaging agents. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Synthetic Peptides intermediate

Diagnostic: Oligopeptide Research Reference

Diagnostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...

Peptide Applications intermediate

Diagnostics Peptides: Biomarker Discovery and Clinical As...

Explore peptide-based diagnostic technologies for disease detection, monitoring, and personalized medicine. This peptide or oligopeptide is studied for its b...

Diagnostics advanced

dialysis for Peptides: Analytical Technique in Peptide Re...

Application of dialysis technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biol...

Structural Biology Techniques advanced

Dialysis Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using Dialysis. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

Diamyd: Oligopeptide Research Reference

Diamyd, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Didinium nasutum: Oligopeptide Research Reference

Discharged from toxicysts upon contact. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Protist Peptides intermediate

Diels Alder Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using Diels Alder for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

Differential Scanning Calorimetry for Peptides

Discover DSC techniques for measuring peptide thermal stability and thermodynamic folding parameters. This peptide or oligopeptide is studied for its biologi...

Peptide Analysis advanced

differential-scanning for Peptides

Application of differential-scanning technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological...

Structural Biology Techniques advanced

diffraction for Peptides: Analytical Technique in Peptide...

Application of diffraction technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...

Structural Biology Techniques advanced

Diffusion Model for Peptides: Comprehensive Peptide Refer...

A computational method for studying peptides using Diffusion Model. This analytical technique provides valuable insights into peptide structure, purity, and ...

Computational Methods advanced

Digital Health Integration: Comprehensive Peptide Reference

Integration of peptide therapeutics with digital health technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Digital Health Peptides: Wearable Biosensors and Smart Di...

Explore peptide-integrated wearable devices for real-time health monitoring and point-of-care diagnostics. This peptide or oligopeptide is studied for its bi...

Digital Health advanced

dihedral-angle Resource: Oligopeptide Research Reference

The dihedral-angle database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Dimensionality Reduction for Peptides

A computational method for studying peptides using Dimensionality Reduction. This analytical technique provides valuable insights into peptide structure, pur...

Computational Methods advanced

Diphtheria Toxin (DT): Peptide Toxin in Pharmacology Refe...

Diphtheria Toxin (DT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Diphtheria Toxin: Peptide Toxin in Pharmacology Reference

Diphtheria Toxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

dipole-moment Resource: Oligopeptide Research Reference

The dipole-moment database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...

Databases & Resources intermediate

Diptericin: Antimicrobial Peptide Reference

Glycine-rich AMP from Drosophila with gram-negative antibacterial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides intermediate

Discodermolide: Oligopeptide Research Reference

Discodermolide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Disease Biomarkers: Oligopeptide Research Reference

Peptide biomarkers for disease diagnosis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Peptide Therapeutics intermediate

Disease Categories Overview: Comprehensive Peptide Reference

Overview of disease categories relevant to peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

Disordered System 1: Oligopeptide Research Reference

A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Disordered System 2: Oligopeptide Research Reference

A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Disordered System 3: Oligopeptide Research Reference

A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

dissociation-constant Resource

The dissociation-constant database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

distance-map Resource: Oligopeptide Research Reference

The distance-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ...

Databases & Resources intermediate

DistilBERT for Peptides: Analytical Technique in Peptide ...

A computational method for studying peptides using DistilBERT. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Computational Methods advanced

Disulfide Bond Formation Synthesis

A peptide synthesis method using Disulfide Bond Formation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...

Peptide Synthesis Methods advanced

Disulfide Bonds in Peptides: Comprehensive Peptide Reference

Overview of disulfide bond formation between cysteine residues in peptide folding. This modification affects peptide stability, receptor binding, and biologi...

Peptide Modifications intermediate

disulfide-map Resource: Oligopeptide Research Reference

The disulfide-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...

Databases & Resources intermediate

Diuretic Hormone: Oligopeptide Research Reference

Diuretic Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

DLS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using DLS. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

DLS for Peptide Size: Analytical Technique in Peptide Res...

Learn dynamic light scattering techniques for measuring peptide particle size, aggregation, and oligomeric state. Covers molecular mechanisms, biological act...

Peptide Analysis intermediate

DNA Conjugation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using DNA Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

DNA methylation: Oligopeptide Research Reference

Comprehensive reference for dna methylation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

DNMT Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting DNMT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

Docking for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using Docking. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

Docking Studies for Peptides: Comprehensive Peptide Refer...

Learn molecular docking methods for predicting peptide-receptor binding poses and interaction energies. This peptide or oligopeptide is studied for its biolo...

Peptide Analysis advanced

Docking Studies: Oligopeptide Research Reference

Computational methods for predicting peptide-protein binding modes. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Dodecapeptide: Oligopeptide Research Reference

Dodecapeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Dolastatin 10: Oligopeptide Research Reference

Dolastatin 10, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Domoic Acid: Oligopeptide Research Reference

Domoic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Donanemab: Oligopeptide Research Reference

Donanemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Dornase Alfa: Oligopeptide Research Reference

dornase alfa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

dose-limiting-toxicity Resource

The dose-limiting-toxicity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

DPDPE: Neuropeptide in Neuroscience Reference

Cyclic delta-opioid peptide agonist with improved metabolic stability. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides intermediate

DPP 4 Inhibitor: Enzyme in Peptide Biology Reference

DPP 4 inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifi...

Enzyme Peptides intermediate

DPP-4 enzyme biology, incretin hypothesis

DPP-4 enzyme biology, incretin hypothesis is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

DPX-E7: Oligopeptide Research Reference

DPX-E7, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

DRAMP: Oligopeptide Research Reference

Database of Research on Antimicrobial Peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Peptide Therapeutics intermediate

Drosomycin: Antimicrobial Peptide Reference

Antifungal defensin from Drosophila hemolymph providing innate immune defense. This antimicrobial peptide demonstrates activity against pathogens and is stud...

Antimicrobial Peptides intermediate

Drug delivery system: Oligopeptide Research Reference

Comprehensive reference for drug delivery system, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Drug Interactions: Oligopeptide Research Reference

Enhanced toxicity or reduced efficacy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Peptide Safety intermediate

DrugBank: Therapeutic Peptide Drug Profile

Comprehensive drug and drug target database combining detailed drug data with drug target information. This peptide or oligopeptide is studied for its biolog...

Drug Development intermediate

DSF Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using DSF. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

DSGYDGSGYDGSGYD: Oligopeptide Research Reference

Streptomyces nodosus. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...

Yeast Peptides intermediate

DSLET: Neuropeptide in Neuroscience Reference

Delta-opioid selective enkephalin analog for pharmacological studies. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

DTNB Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using DTNB. This analytical technique provides valuable insights into peptide structure, purit...

Purification Methods advanced

DTx1: Peptide Toxin in Pharmacology Reference

DTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

DTx3: Peptide Toxin in Pharmacology Reference

DTx3 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Dual Agonists in Obesity: Oligopeptide Research Reference

A review of GIP/GLP-1 dual receptor agonists for obesity treatment, including retatrutide and survodutide, with analysis of clinical trial outcomes and weigh...

GLP-1 Analogs intermediate

DUAL I Trial: Oligopeptide Research Reference

Phase 3 trial demonstrating superiority of degludec-liraglutide over glargine in HbA1c reduction with less hypoglycemia.

Peptide Drugs advanced

Duck Cathelicidin (ApCATH): Comprehensive Peptide Reference

Comprehensive reference for Duck Cathelicidin (ApCATH), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Duck Cathelicidin: Oligopeptide Research Reference

Duck Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Duck Defensin: Oligopeptide Research Reference

Duck Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Dulaglutide Fc Fusion Technology

Once-weekly GLP-1 receptor agonist using human IgG4 Fc domain fusion for extended half-life through FcRn-mediated recycling.

GLP-1 Family intermediate

Dulaglutide: Oligopeptide Research Reference

Long-acting GLP-1 receptor agonist fused to human IgG4 Fc for once-weekly type 2 diabetes treatment. This peptide or oligopeptide is studied for its biologic...

GLP-1 Analogs intermediate

Dulaglutide: Oligopeptide Research Reference

Once-weekly GLP-1 agonist fused to modified Fc domain for extended half-life and DPP-4 resistance. This peptide or oligopeptide is studied for its biological...

Peptide Drugs intermediate

duration-of-response Resource: Comprehensive Peptide Refe...

The duration-of-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Durvalumab: Oligopeptide Research Reference

durvalumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Dynamic Light Scattering: Oligopeptide Research Reference

DLS for measuring peptide size distribution and aggregation state. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

dynamic-light-scattering for Peptides

Application of dynamic-light-scattering technique for peptide characterization, structure determination, or formulation.

Structural Biology Techniques advanced

Dynorphin A 1-13: Neuropeptide in Neuroscience Reference

Truncated dynorphin A with retained kappa-opioid selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...

Neuropeptides intermediate

Dynorphin A-1-10: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-11: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-11 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-12: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-14: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-15: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-16: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-17: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-8: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A-1-9: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin A-1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin A: Neuropeptide in Neuroscience Reference

A 17-amino acid opioid neuropeptide derived from prodynorphin that preferentially activates kappa-opioid receptors, mediating pain modulation, stress respons...

Neuropeptides intermediate

Dynorphin B-1-13: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin B-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin B-1-14: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin B-1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin B-1-15: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin B-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin B-1-16: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin B-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin B-1-17: Neuropeptide in Neuroscience Reference

Comprehensive reference for dynorphin B-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Dynorphin B: Neuropeptide in Neuroscience Reference

Prodynorphin-derived opioid with kappa-opioid receptor selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Dynorphin Paradoxical Pain: Comprehensive Peptide Reference

Paradoxical pronociceptive effects of dynorphin through non-opioid mechanisms. This neuropeptide is involved in neurological signaling and is studied for its...

Neuropeptides advanced

Dynorphin Stress Response: Comprehensive Peptide Reference

Role of dynorphin/kappa-opioid system in stress and dysphoria. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides intermediate

E Coli Esbl Peptide: Oligopeptide Research Reference

A peptide associated with E Coli Esbl for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

E Coli Peptide: Oligopeptide Research Reference

A peptide associated with E Coli for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-act...

Microbial Peptides intermediate

E Faecium Peptide: Oligopeptide Research Reference

A peptide associated with E Faecium for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-...

Microbial Peptides intermediate

E Faecium Vre Peptide: Oligopeptide Research Reference

A peptide associated with E Faecium Vre for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

E Rhusiopathiae Peptide: Oligopeptide Research Reference

A peptide associated with E Rhusiopathiae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...

Microbial Peptides intermediate

Earthworm Antimicrobial / Lysozyme

Earthworm Antimicrobial / Lysozyme is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ac...

Worm Peptides intermediate

Earthworm Antimicrobial Peptide

Earthworm Antimicrobial Peptide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Worm Peptides intermediate

Earthworm Fibrinolytic Enzyme (EFE)

Comprehensive reference for Earthworm Fibrinolytic Enzyme (EFE), a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Ebola GP Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Ebola GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Ebola Peptides: Oligopeptide Research Reference

Peptides associated with Ebola including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ...

Disease-Associated Peptides intermediate

EBV LMP1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting EBV LMP1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

EBV LMP2 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting EBV LMP2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Ebv Peptides: Oligopeptide Research Reference

Peptides associated with Ebv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...

Disease-Associated Peptides intermediate

Ecallantide: Oligopeptide Research Reference

Plasma kallikrein inhibitor for hereditary angioedema preventing bradykinin generation. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Drugs intermediate

Echinocandin B: Oligopeptide Research Reference

Echinocandin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Echinococcus Peptides: Oligopeptide Research Reference

Echinococcus Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Eclosion Hormone: Oligopeptide Research Reference

Eclosion Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Ecnoglutide: Oligopeptide Research Reference

Ecnoglutide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Eculizumab: Oligopeptide Research Reference

eculizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Eczema Peptides: Oligopeptide Research Reference

Peptides associated with Eczema including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Edman Degradation: Analytical Technique in Peptide Research

Understand the Edman degradation method for sequential N-terminal sequencing of peptides and proteins. This peptide or oligopeptide is studied for its biolog...

Peptide Analysis intermediate

edX Protein Engineering: Oligopeptide Research Reference

Online course on protein engineering principles and applications. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

efficacy-endpoint Resource: Comprehensive Peptide Reference

The efficacy-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Efinopegdutide: Oligopeptide Research Reference

Once-weekly PEGylated GLP-1 agonist for NASH treatment in clinical development. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Drugs advanced

Efpeglenatide: Oligopeptide Research Reference

efpeglenatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Drugs intermediate

Efpeglenatide: Oligopeptide Research Reference

Long-acting GLP-1 agonist with albumin-binding fatty acid for once-monthly dosing. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Drugs advanced

Efrapeptin: Oligopeptide Research Reference

Efrapeptin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Efruxifermin: Oligopeptide Research Reference

Efruxifermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

EGCG Peptide: Oligopeptide Research Reference

EGCG peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Antioxidant Peptides intermediate

EGF Hormone: Endogenous Peptide Hormone Reference

EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

EGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting EGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

EGF Peptide Hormone: Endogenous Peptide Hormone Reference

EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

EGF Protein Hormone: Endogenous Peptide Hormone Reference

EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

EGFR Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting EGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

EGFR Inhibitor: Oligopeptide Research Reference

EGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Signaling Peptides intermediate

Egg Ovotransferrin: Oligopeptide Research Reference

egg ovotransferrin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Food-Derived Peptides intermediate

Egg White Peptides: Oligopeptide Research Reference

Egg White Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Egg Yolk Peptides: Oligopeptide Research Reference

Egg Yolk Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Eggplant Peptide: Oligopeptide Research Reference

A bioactive peptide derived from eggplant with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

Eggshell Matrix Peptides: Oligopeptide Research Reference

Comprehensive reference for Eggshell Matrix Peptides, a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Eggshell Peptides: Oligopeptide Research Reference

Eggshell Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Eiseniapore: Oligopeptide Research Reference

Eiseniapore, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Elagolix: Oligopeptide Research Reference

Oral GnRH antagonist for endometriosis-associated pain with dose-dependent estrogen suppression. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs intermediate

Elastic Network for Peptides: Comprehensive Peptide Refer...

A computational method for studying peptides using Elastic Network. This analytical technique provides valuable insights into peptide structure, purity, and ...

Computational Methods advanced

Elastin Binding Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Elastin Binding. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Elastin peptide: Structure, Function, and Significance

Elastin-derived peptides contain VPGVG repeats that provide elasticity to connective tissues. They are used in cosmetic and nutraceutical products.

Structural Peptides intermediate

Elastin Peptides (Marine): Comprehensive Peptide Reference

Comprehensive reference for Elastin Peptides (Marine), a peptide compound with applications in research and therapeutics.

Marine Peptides intermediate

Elcatonin: Oligopeptide Research Reference

Synthetic eel calcitonin analogue with reduced immunogenicity for osteoporosis treatment. This peptide or oligopeptide is studied for its biological activity...

Peptide Drugs intermediate

ELECTRA for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using ELECTRA. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

Electrochemical Synthesis: Comprehensive Peptide Reference

mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Electrochemical Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Electrochemical for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Electrochemiluminescence: Oligopeptide Research Reference

Roche platforms. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...

Biomarkers Expanded intermediate

electron-affinity Resource: Comprehensive Peptide Reference

The electron-affinity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

electronegativity Resource: Comprehensive Peptide Reference

The electronegativity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

electrophoresis for Peptides: Comprehensive Peptide Refer...

Application of electrophoresis technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...

Structural Biology Techniques advanced

Electrophoresis: Oligopeptide Research Reference

Electrophoresis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Electrophoretic Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Electrophoretic for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

electrospinning for Peptides: Comprehensive Peptide Refer...

Application of electrospinning technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...

Structural Biology Techniques advanced

Electrospray Ionization MS for Peptides

Learn ESI-MS methods for peptide sequencing, quantification, and characterization of post-translational modifications. Covers molecular mechanisms, biologica...

Peptide Analysis advanced

Electrospun Fiber Peptide Delivery

Explore electrospun nanofiber scaffolds for localized peptide delivery in wound healing and tissue repair. This peptide or oligopeptide is studied for its bi...

Drug Delivery advanced

electrostatic-potential Resource

The electrostatic-potential database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Eli Lilly: Oligopeptide Research Reference

Tirzepatide, Dulaglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Patents intermediate

ELISA Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using ELISA. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

ELISA for Peptide Detection: Comprehensive Peptide Reference

Learn enzyme-linked immunosorbent assay methods for sensitive quantitative peptide detection in biological samples. Covers molecular mechanisms, biological a...

Peptide Analysis beginner

Elisidepsin: Oligopeptide Research Reference

Elisidepsin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

ELISPOT Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using ELISPOT. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

Ellman Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using Ellman. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

Ellmans Reagent Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Ellmans Reagent. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Elosulfase Alfa: Oligopeptide Research Reference

Elosulfase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

EMA EPAR: Oligopeptide Research Reference

European Medicines Agency European Public Assessment Reports for drugs. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

EMA Peptide Drug Approval: Comprehensive Peptide Reference

Understand the European Medicines Agency process for peptide drug authorization including centralized procedure steps. Covers molecular mechanisms, biologica...

Regulatory advanced

Embedding for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using Embedding. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

EMDB: Oligopeptide Research Reference

Electron Microscopy Data Bank for cryo-EM structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...

Peptide Therapeutics intermediate

Emerging Therapeutic Strategies

Comprehensive reference for Emerging Therapeutic Strategies, a peptide compound with applications in research and therapeutics.

Bacterial Peptides intermediate

Emulsified Peptide Delivery: Comprehensive Peptide Reference

Oil-in-water emulsions for oral peptide delivery with lipid-based absorption enhancement. This peptide or oligopeptide is studied for its biological activity...

Drug Delivery intermediate

emulsion for Peptides: Analytical Technique in Peptide Re...

Application of emulsion technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biol...

Structural Biology Techniques advanced

Enalaprilat: Oligopeptide Research Reference

Active metabolite of enalapril and intravenous ACE inhibitor for hypertensive emergencies and heart failure. This peptide or oligopeptide is studied for its ...

Cardiovascular Peptides intermediate

Enalaprilat: Oligopeptide Research Reference

Enalaprilat, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Endocannabinoid Peptides: Neuropeptide in Neuroscience Re...

Lipid-peptide mediators of retrograde synaptic signaling in CNS. This neuropeptide is involved in neurological signaling and is studied for its roles in brai...

Neuropeptides advanced

Endocrine / Somatostatin Analog

Endocrine / Somatostatin Analog is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Peptide Analogs intermediate

Endocrine / Vasopressin: Oligopeptide Research Reference

Endocrine / Vasopressin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...

Peptide Analogs intermediate

Endocrine: Endogenous Peptide Hormone Reference

Clinical trials for endocrine-related diseases. This endogenous peptide hormone plays important roles in physiological regulation and is studied for therapeu...

Peptide Therapeutics intermediate

Endogenous opioid peptide: Comprehensive Peptide Reference

Endogenous opioid peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...

Neuropeptides intermediate

Endogenous Opioid System: Neuropeptide in Neuroscience Re...

Overview of opioid peptides, receptors, and roles in pain and reward. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

Endokinin A: Neuropeptide in Neuroscience Reference

endokinin-A is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...

Neuropeptides intermediate

Endokinin B: Neuropeptide in Neuroscience Reference

endokinin-B is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...

Neuropeptides intermediate

Endometrial Cancer Peptides: Comprehensive Peptide Reference

Peptides associated with Endometrial Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...

Disease-Associated Peptides intermediate

Endomorphin-1: Neuropeptide in Neuroscience Reference

Highly selective mu-opioid endogenous peptide from hypothalamus. This neuropeptide is involved in neurological signaling and is studied for its roles in brai...

Neuropeptides intermediate

Endomorphin-2: Neuropeptide in Neuroscience Reference

Mu-opioid selective peptide with preferential spinal cord distribution. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides intermediate

Endorphin alpha-1-16: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-17: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-18: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-19: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-20: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-21: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-22: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-23: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin alpha-1-24: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin alpha-1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin Alpha: Neuropeptide in Neuroscience Reference

endorphin-alpha is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Endorphin beta-1-16: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-17: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-18: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-19: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-20: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-21: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-22: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-23: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-24: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-25: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin beta-1-26: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin beta-1-26 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin Beta: Neuropeptide in Neuroscience Reference

endorphin-beta is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Endorphin gamma-1-16: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin gamma-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin gamma-1-17: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin gamma-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin gamma-1-18: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin gamma-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin gamma-1-19: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin gamma-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin gamma-1-20: Neuropeptide in Neuroscience Reference

Comprehensive reference for endorphin gamma-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Endorphin Gamma: Neuropeptide in Neuroscience Reference

endorphin-gamma is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Endorphin Pain Modulation: Comprehensive Peptide Reference

Endorphin-mediated descending pain inhibition from brainstem to spinal cord. This neuropeptide is involved in neurological signaling and is studied for its r...

Neuropeptides advanced

Endothelin 1 Hormone: Endogenous Peptide Hormone Reference

Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 1 Peptide Hormone: Comprehensive Peptide Refer...

Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 1 Protein Hormone: Comprehensive Peptide Refer...

Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 1: Oligopeptide Research Reference

endothelin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Cardiovascular Peptides intermediate

Endothelin 1: Oligopeptide Research Reference

Potent vasoconstrictor 21-amino acid peptide from endothelial cells that regulates vascular tone and blood pressure. Covers molecular mechanisms, biological ...

Cardiovascular Peptides advanced

Endothelin 2 Hormone: Endogenous Peptide Hormone Reference

Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 2 Peptide Hormone: Comprehensive Peptide Refer...

Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 2 Protein Hormone: Comprehensive Peptide Refer...

Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 3 Hormone: Endogenous Peptide Hormone Reference

Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 3 Peptide Hormone: Comprehensive Peptide Refer...

Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 3 Protein Hormone: Comprehensive Peptide Refer...

Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Endothelin 3: Oligopeptide Research Reference

endothelin 3 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Cardiovascular Peptides intermediate

Endothelin Family Peptides: Comprehensive Peptide Reference

Guide to endothelin peptides ET-1, ET-2, ET-3 in vasoconstriction and cardiovascular regulation. This peptide or oligopeptide is studied for its biological a...

Peptide Families advanced

Enfortumab Vedotin: Oligopeptide Research Reference

Antibody-drug conjugate targeting Nectin-4 with monomethyl auristatin E payload for urothelial cancer. This peptide or oligopeptide is studied for its biolog...

Peptide-Drug Conjugates advanced

Enfuvirtide: Oligopeptide Research Reference

enfuvirtide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Enfuvirtide: Oligopeptide Research Reference

Synthetic 36-amino acid peptide HIV fusion inhibitor that blocks gp41-mediated viral entry into CD4 cells. This peptide or oligopeptide is studied for its bi...

Antiviral Peptides advanced

Enfuvirtide: Oligopeptide Research Reference

Fusion inhibitor peptide blocking HIV gp41-mediated membrane fusion for treatment-experienced patients. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs intermediate

Enhanced Sampling for Peptides

A computational method for studying peptides using Enhanced Sampling. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Enkephalin leu-1-2: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-3: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-4: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-6: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-7: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-1-8: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-2-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-2-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-3-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-3-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin leu-4-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin leu-4-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-2: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-3: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-4: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-6: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-7: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-1-8: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-2-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-2-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-3-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-3-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin met-4-5: Neuropeptide in Neuroscience Reference

Comprehensive reference for enkephalin met-4-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

Enkephalin Pain Modulation: Comprehensive Peptide Reference

Enkephalin-mediated pain modulation in spinal cord and brainstem. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...

Neuropeptides intermediate

Enkephalin Spinal Analgesia: Comprehensive Peptide Reference

Segmental enkephalin-mediated pain inhibition in dorsal horn. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...

Neuropeptides advanced

Enniatin: Oligopeptide Research Reference

Enniatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Enoxaparin: Oligopeptide Research Reference

enoxaparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Ensembl (Genomic): Oligopeptide Research Reference

Genomic database for genome annotation and comparative genomics. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

Ensembl: Oligopeptide Research Reference

Genome browser and annotation database. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

Enteric Coated Peptide Capsules

Enteric coatings protecting peptides from gastric acid and enzymes. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Drug Delivery beginner

Enteric Coating for Peptides: Comprehensive Peptide Refer...

Explore enteric polymer coatings that protect oral peptides from gastric degradation in the stomach. This peptide or oligopeptide is studied for its biologic...

Drug Delivery intermediate

Enteric Defensin HD5: Antimicrobial Peptide Reference

Paneth cell defensin critical for intestinal stem cell niche and microbiome composition. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Enterokinase Cleavage Purification

A purification technique for separating and isolating peptides using Enterokinase Cleavage. This analytical technique provides valuable insights into peptide...

Purification Methods advanced

Environmental Remediation: Comprehensive Peptide Reference

Comprehensive reference for Environmental Remediation, a peptide compound with applications in research and therapeutics.

Peptide Applications intermediate

Enzymatic Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Enzymatic for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Enzymatic Synthesis: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Enzyme Cleavable Purification: Comprehensive Peptide Refe...

A purification technique for separating and isolating peptides using Enzyme Cleavable. This analytical technique provides valuable insights into peptide stru...

Purification Methods advanced

Enzyme Conjugation Synthesis: Comprehensive Peptide Refer...

A peptide synthesis method using Enzyme Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights int...

Peptide Synthesis Methods advanced

Enzyme-linked immunosorbent assay

Research, clinical. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Biomarkers Expanded intermediate

Ephrin A1 Agonist: Oligopeptide Research Reference

ephrin A1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Neurological Peptides intermediate

Epibatidine: Peptide Toxin in Pharmacology Reference

Epibatidine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Epidermal Growth Factor 1-20: Comprehensive Peptide Refer...

Comprehensive reference for epidermal growth factor 1-20, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 1-30: Comprehensive Peptide Refer...

Comprehensive reference for epidermal growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 1-40: Comprehensive Peptide Refer...

Comprehensive reference for epidermal growth factor 1-40, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 1-48: Comprehensive Peptide Refer...

Comprehensive reference for epidermal growth factor 1-48, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 1-53: Comprehensive Peptide Refer...

Comprehensive reference for epidermal growth factor 1-53, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 10-53: Comprehensive Peptide Refe...

Comprehensive reference for epidermal growth factor 10-53, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 20-53: Comprehensive Peptide Refe...

Comprehensive reference for epidermal growth factor 20-53, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 30-53: Comprehensive Peptide Refe...

Comprehensive reference for epidermal growth factor 30-53, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor 40-53: Comprehensive Peptide Refe...

Comprehensive reference for epidermal growth factor 40-53, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Epidermal Growth Factor Family

Learn about EGF, TGF-alpha, and amphiregulin in epithelial growth and cancer biology. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Families advanced

Epidermin: Antimicrobial Peptide Reference

epidermin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biologi...

Antimicrobial Peptides intermediate

Epigenetics: Oligopeptide Research Reference

Comprehensive reference for epigenetics, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Epilepsy Peptides: Oligopeptide Research Reference

Peptides associated with Epilepsy including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Epilepsy: Oligopeptide Research Reference

Neuronal hyperexcitability causing recurrent unprovoked seizures. Classification: focal (partial) or generalized. Etiology: idiopathic (genetic, 60%), sympto...

Peptide Therapeutics intermediate

Epinecidin-1: Oligopeptide Research Reference

Epinecidin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

EPO Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting EPO Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Epoetin Alfa: Oligopeptide Research Reference

epoetin alfa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Epoetin Alfa: Oligopeptide Research Reference

Recombinant human erythropoietin for anemia treatment in chronic kidney disease and chemotherapy. This peptide or oligopeptide is studied for its biological ...

Hematopoietic Peptides beginner

EPR for Peptides: Analytical Technique in Peptide Research

Application of EPR technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...

Structural Biology Techniques advanced

Epsilon Bungarotoxin: Peptide Toxin in Pharmacology Refer...

epsilon-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its phar...

Venom Peptides intermediate

Eptifibatide: Oligopeptide Research Reference

eptifibatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Eptifibatide: Oligopeptide Research Reference

Cyclic heptapeptide GPIIb/IIIa inhibitor derived from rattlesnake venom, used for acute coronary syndromes and PCI. Covers molecular mechanisms, biological a...

Cardiovascular Peptides advanced

Eptifibatide: Oligopeptide Research Reference

Cyclic heptapeptide GP IIb/IIIa inhibitor containing KGD for acute coronary syndromes. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Drugs intermediate

Eptinezumab: Oligopeptide Research Reference

Anti-CGRP monoclonal antibody for migraine prevention administered as quarterly IV infusion. This peptide or oligopeptide is studied for its biological activ...

Peptide Drugs intermediate

EPV-01: Oligopeptide Research Reference

EPV-01, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Erabutoxin: Structure, Function, and Significance

Erabutoxins are three-finger toxins from sea snake venom that block neuromuscular junction acetylcholine receptors. Covers molecular mechanisms, biological a...

Venom Peptides intermediate

Eravacycline: Oligopeptide Research Reference

Eravacycline, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Erenumab: Oligopeptide Research Reference

Monoclonal antibody against CGRP receptor for migraine prevention with monthly dosing. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Drugs intermediate

Ergocristine: Oligopeptide Research Reference

Ergocristine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Ergotamine: Oligopeptide Research Reference

Ergotamine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Eribulin Mesylate: Oligopeptide Research Reference

Synthetic halichondrin B analog microtubule dynamics inhibitor for metastatic breast cancer and liposarcoma. This peptide or oligopeptide is studied for its ...

Anticancer Peptides advanced

Eribulin: Oligopeptide Research Reference

Eribulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Erinaceins: Peptide Toxin in Pharmacology Reference

erinaceins is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

ERK Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting ERK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Erythropoietin Hormone: Endogenous Peptide Hormone Reference

Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Erythropoietin Peptide Hormone

Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Erythropoietin Protein Hormone

Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Erythropoietin: Endogenous Peptide Hormone Reference

Glycoprotein hormone that stimulates red blood cell production through EPO receptor activation on erythroid progenitor cells.

Hematopoietic Peptides intermediate

Esculentin 1a: Antimicrobial Peptide Reference

esculentin-1a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...

Antimicrobial Peptides intermediate

Esculentin 2a: Antimicrobial Peptide Reference

esculentin-2a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...

Antimicrobial Peptides intermediate

Esculentin 2EM: Antimicrobial Peptide Reference

esculentin-2EM is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...

Antimicrobial Peptides intermediate

Esculentin-1: Antimicrobial Peptide Reference

Esculentin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Esculentin-2: Antimicrobial Peptide Reference

Esculentin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Esculentin: Antimicrobial Peptide Reference

Potent frog AMP active against Pseudomonas aeruginosa in wound infections. This antimicrobial peptide demonstrates activity against pathogens and is studied ...

Antimicrobial Peptides intermediate

ESM for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using ESM. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...

Computational Methods advanced

ESMFold for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using ESMFold. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

ESMFold: Oligopeptide Research Reference

ESMFold, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Technologies intermediate

ESMFold2 for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using ESMFold2. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

ESMFold3 for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using ESMFold3. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

Esophageal Cancer Peptides: Comprehensive Peptide Reference

Peptides associated with Esophageal Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...

Disease-Associated Peptides intermediate

Essential Dynamics for Peptides

A computational method for studying peptides using Essential Dynamics. This analytical technique provides valuable insights into peptide structure, purity, a...

Computational Methods advanced

Ester Bonds in Peptides: Post-Translational Modification ...

Overview of ester bonds in depsipeptides and their role in cyclic peptide design. This modification affects peptide stability, receptor binding, and biologic...

Peptide Modifications advanced

Estradiol Hormone: Endogenous Peptide Hormone Reference

Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Estradiol Peptide Hormone: Comprehensive Peptide Reference

Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Estradiol Protein Hormone: Comprehensive Peptide Reference

Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Eteplirsen: Oligopeptide Research Reference

Eteplirsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Ethanol Precipitation Purification

A purification technique for separating and isolating peptides using Ethanol Precipitation. This analytical technique provides valuable insights into peptide...

Purification Methods advanced

Etorphine: Neuropeptide in Neuroscience Reference

Extremely potent semi-synthetic opioid for veterinary immobilization. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

EU Clinical Trials Register: Comprehensive Peptide Reference

Database of clinical trials conducted in the European Union. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...

Peptide Therapeutics intermediate

European Peptide Symposium: Comprehensive Peptide Reference

European conference for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Evaporation Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Evaporation. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

Everolimus: Oligopeptide Research Reference

Derivative of sirolimus that inhibits mTOR, used in transplant immunosuppression, oncology, and tuberous sclerosis treatment.

Immunomodulatory Peptides advanced

Evolution of Peptide Synthesis

Comprehensive reference for Evolution of Peptide Synthesis, a peptide compound with applications in research and therapeutics.

Peptide Patents intermediate

Evolution of Peptide Synthesis Methods

How peptide synthesis techniques evolved from solution-phase to solid-phase and beyond. This peptide or oligopeptide is studied for its biological activity, ...

Peptide History intermediate

Exenatide - DURATION-1 (NCT00207469)

Duration-1 trial comparing exenatide to glimepiride in type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Exenatide (Exendin-4): Oligopeptide Research Reference

Exenatide (Exendin-4), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Exenatide Extended Release: Comprehensive Peptide Reference

Once-weekly exenatide in poly(lactide-co-glycolide) microspheres for sustained 7-day release. This peptide or oligopeptide is studied for its biological acti...

Peptide Drugs intermediate

Exenatide Once Weekly: Peptide Family Reference

Extended-release microsphere formulation of exenatide providing sustained GLP-1 receptor agonism with once-weekly dosing.

GLP-1 Family intermediate

Exenatide Twice Daily: Peptide Family Reference

First-in-class short-acting GLP-1 receptor agonist derived from Gila monster exendin-4, administered twice daily. Covers molecular mechanisms, biological act...

GLP-1 Family intermediate

Exenatide: Oligopeptide Research Reference

exenatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Exenatide: Oligopeptide Research Reference

First-in-class GLP-1 agonist from Gila monster saliva, twice-daily injection for type 2 diabetes. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs beginner

Exendin-3: Oligopeptide Research Reference

39-aa peptide from Gila monster saliva. Related to exendin-4 but less potent at GLP-1 receptor. This peptide or oligopeptide is studied for its biological ac...

Peptide Therapeutics intermediate

Exendin-4 (Exenatide): Oligopeptide Research Reference

Exendin-4 (Exenatide), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Exendin-4: Oligopeptide Research Reference

Exendin-4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Exosome Delivery: Oligopeptide Research Reference

Using exosomes as natural nanoparticles for peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Exosome Peptide Delivery: Oligopeptide Research Reference

Understand exosome-based nanocarriers for delivering therapeutic peptides across biological barriers. This peptide or oligopeptide is studied for its biologi...

Drug Delivery advanced

Exosome: Oligopeptide Research Reference

Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...

Peptide Technologies intermediate

exploratory-endpoint Resource: Comprehensive Peptide Refe...

The exploratory-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

exposure-response Resource: Comprehensive Peptide Reference

The exposure-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Expressed Protein Ligation Synthesis

A peptide synthesis method using Expressed Protein Ligation for producing peptides with specific properties. This peptide or oligopeptide is studied for its ...

Peptide Synthesis Methods advanced

Extraction: Oligopeptide Research Reference

Extraction, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

extrusion for Peptides: Analytical Technique in Peptide R...

Application of extrusion technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bio...

Structural Biology Techniques advanced

Extrusion Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Extrusion for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Extrusome-mediated toxic discharge

Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

Eye Disease and Peptides: Oligopeptide Research Reference

Discover peptide therapeutics for ocular diseases including macular degeneration, glaucoma, and dry eye. This peptide or oligopeptide is studied for its biol...

Peptide Therapeutics intermediate

Eyeseryl: Oligopeptide Research Reference

Acetyl tetrapeptide-5 (Ac-β-Ala-His-Ser-Ser). Reduces periorbital puffiness and dark circles. Inhibits glycation of collagen, increases lymphatic drainage, r...

Peptide Therapeutics intermediate

F1-score Resource: Oligopeptide Research Reference

The F1-score database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Fab Conjugation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Fab Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Fab fragment: Oligopeptide Research Reference

Comprehensive reference for fab fragment, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Fab System 1: Oligopeptide Research Reference

A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

Fab System 2: Oligopeptide Research Reference

A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

Fab System 3: Oligopeptide Research Reference

A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

Fabry Disease: Oligopeptide Research Reference

α-galactosidase A deficiency → GL-3 accumulation. Treatments: agalsidase, migalastat. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Therapeutics intermediate

Factor VIIa: Oligopeptide Research Reference

factor VIIa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Factor Xa Cleavage Purification

A purification technique for separating and isolating peptides using Factor Xa Cleavage. This analytical technique provides valuable insights into peptide st...

Purification Methods advanced

Factor Xa Inhibitor: Enzyme in Peptide Biology Reference

factor Xa inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spe...

Enzyme Peptides intermediate

Farnesylated pheromone binds Map3p receptor

Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

Farnesylated pheromone binds Ste3p GPCR receptor

Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

Fasciculin 1: Peptide Toxin in Pharmacology Reference

fasciculin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...

Venom Peptides intermediate

Fasciculin 2: Peptide Toxin in Pharmacology Reference

fasciculin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...

Venom Peptides intermediate

Fasciola Peptides: Oligopeptide Research Reference

Fasciola Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Faster-Acting Insulin Aspart: Comprehensive Peptide Refer...

Next-generation rapid-acting insulin aspart formulation with niacinamide and L-arginine for accelerated initial absorption.

Insulin Family intermediate

FastText for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using FastText. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

Fc Fusion System 1: Oligopeptide Research Reference

A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Fc Fusion System 2: Oligopeptide Research Reference

A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Fc Fusion System 3: Oligopeptide Research Reference

A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Fc fusion: Oligopeptide Research Reference

Comprehensive reference for fc fusion, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

FcRn Modulator: Oligopeptide Research Reference

FcRn modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Immune Peptides intermediate

FDA Orange Book: Oligopeptide Research Reference

FDA database of approved drug products with therapeutic equivalence evaluations. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

FDA Peptide Drug Approval: Comprehensive Peptide Reference

Navigate the FDA regulatory pathway for peptide drug approval including IND, NDA, and BLA submission requirements. Covers molecular mechanisms, biological ac...

Regulatory advanced

Feather Keratin Peptides: Oligopeptide Research Reference

Comprehensive reference for Feather Keratin Peptides, a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

Feather Keratin-Derived Peptides

Comprehensive reference for Feather Keratin-Derived Peptides, a peptide compound with applications in research and therapeutics.

Specialized Peptides intermediate

Feline Antimicrobial: Oligopeptide Research Reference

Feline Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Mammalian Peptides intermediate

Feline Beta-Defensin: Oligopeptide Research Reference

Feline Beta-Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Feline Cathelicidin: Oligopeptide Research Reference

Feline Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Feline Defensin: Oligopeptide Research Reference

Feline Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Feline Neutrophil Peptide: Comprehensive Peptide Reference

Comprehensive reference for Feline Neutrophil Peptide, a peptide compound with applications in research and therapeutics.

Mammalian Peptides intermediate

Feline Serum Peptide: Oligopeptide Research Reference

Feline Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Fentanyl Synthetic Opioid: Comprehensive Peptide Reference

Potent synthetic opioid with rapid onset and short duration for anesthesia. This neuropeptide is involved in neurological signaling and is studied for its ro...

Neuropeptides intermediate

Fentanyl: Oligopeptide Research Reference

Fentanyl, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Ferring: Oligopeptide Research Reference

Degarelix. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...

Peptide Patents intermediate

Ferritin: Oligopeptide Research Reference

Iron-storage protein. Inflammation marker, iron deficiency indicator. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Fertility and Peptides: Oligopeptide Research Reference

Discover gonadotropin peptides and GnRH analogs for treating infertility and reproductive disorders. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

FFF Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using FFF. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

FGF 1 Hormone: Endogenous Peptide Hormone Reference

FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 1 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 1 Protein Hormone: Endogenous Peptide Hormone Reference

FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 2 Hormone: Endogenous Peptide Hormone Reference

FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 2 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 2 Protein Hormone: Endogenous Peptide Hormone Reference

FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 21 Hormone: Endogenous Peptide Hormone Reference

FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

FGF 21 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

FGF 21 Protein Hormone: Endogenous Peptide Hormone Reference

FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

FGF 7 Hormone: Endogenous Peptide Hormone Reference

FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 7 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF 7 Protein Hormone: Endogenous Peptide Hormone Reference

FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting FGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

FGF21 1-100: Endogenous Peptide Hormone Reference

Comprehensive reference for FGF21 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

FGF21 1-150: Endogenous Peptide Hormone Reference

Comprehensive reference for FGF21 1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

FGF21 1-181: Endogenous Peptide Hormone Reference

Comprehensive reference for FGF21 1-181 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

FGF21 100-181: Endogenous Peptide Hormone Reference

Comprehensive reference for FGF21 100-181 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

FGF21 150-181: Endogenous Peptide Hormone Reference

Comprehensive reference for FGF21 150-181 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

FGF21 Hormone: Endogenous Peptide Hormone Reference

FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF21 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF21 Protein Hormone: Endogenous Peptide Hormone Reference

FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF21: Structure, Function, and Significance

Fibroblast growth factor 21 is a metabolic hormone that regulates glucose uptake, lipid metabolism, and insulin sensitivity.

Peptide Hormones intermediate

FGF23 Hormone: Endogenous Peptide Hormone Reference

FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF23 Peptide Hormone: Endogenous Peptide Hormone Reference

FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGF23 Protein Hormone: Endogenous Peptide Hormone Reference

FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FGFR Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting FGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

FGFR Inhibitor: Oligopeptide Research Reference

FGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Signaling Peptides intermediate

FIA Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using FIA. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

Fiasp Formulation Science: Comprehensive Peptide Reference

Formulation science behind faster insulin aspart including niacinamide vasodilation and citrate-mediated pH reduction. Covers molecular mechanisms, biologica...

Peptide Drugs advanced

Fiber Assembly System 1: Oligopeptide Research Reference

A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Fiber Assembly System 2: Oligopeptide Research Reference

A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Fiber Assembly System 3: Oligopeptide Research Reference

A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Fibrinogen → Fibrin (Thrombin Cleavage)

Comprehensive reference for Fibrinogen → Fibrin (Thrombin Cleavage), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Fibrinogen: Oligopeptide Research Reference

340 kDa glycoprotein (Aα, Bβ, γ)₂ hexamer. 340-aa Aα chains, 461-aa Bβ chains, 411-aa γ chains. Converted to fibrin by thrombin (cleaves fibrinopeptides A an...

Peptide Therapeutics intermediate

Fibroblast Growth Factor 1-100

Comprehensive reference for fibroblast growth factor 1-100, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroblast Growth Factor 1-155

Comprehensive reference for fibroblast growth factor 1-155, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroblast Growth Factor 1-50: Comprehensive Peptide Refe...

Comprehensive reference for fibroblast growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroblast Growth Factor Family

Overview of FGF family peptides in cell proliferation, development, and tissue repair. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Families advanced

Fibroblast Growth Factor fragment-1-30

Comprehensive reference for fibroblast growth factor fragment-1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroblast Growth Factor fragment-100-155

Comprehensive reference for fibroblast growth factor fragment-100-155, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroblast Growth Factor fragment-50-100

Comprehensive reference for fibroblast growth factor fragment-50-100, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Fibroin Heavy Chain (Bombyx): Comprehensive Peptide Refer...

Comprehensive reference for Fibroin Heavy Chain (Bombyx), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

Fibroin Light Chain (Bombyx): Comprehensive Peptide Refer...

Comprehensive reference for Fibroin Light Chain (Bombyx), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

Fibromyalgia Peptides: Oligopeptide Research Reference

Peptides associated with Fibromyalgia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Fibronectin peptide: Structure, Function, and Significance

RGDS is a fibronectin-derived cell-adhesion peptide that binds integrins and is widely used in tissue engineering and biomaterials.

Structural Peptides intermediate

Filgrastim: Oligopeptide Research Reference

filgrastim in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Filgrastim: Oligopeptide Research Reference

Recombinant G-CSF that stimulates neutrophil production and mobilization for chemotherapy-induced neutropenia and stem cell collection.

Hematopoietic Peptides intermediate

Filipin: Oligopeptide Research Reference

Filipin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

filtration for Peptides: Analytical Technique in Peptide ...

Application of filtration technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...

Structural Biology Techniques advanced

Filtration Purification: Analytical Technique in Peptide ...

A purification technique for separating and isolating peptides using Filtration. This analytical technique provides valuable insights into peptide structure,...

Purification Methods advanced

Fish Antifreeze Peptide: Oligopeptide Research Reference

fish antifreeze peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Food-Derived Peptides intermediate

Fish Antimicrobial: Oligopeptide Research Reference

Fish Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological...

Fish Peptides intermediate

Fish Beta-Defensin: Antimicrobial Peptide Reference

Mucosal defensin in fish skin and gills for aquatic innate immunity. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...

Antimicrobial Peptides intermediate

Fish Bone Collagen: Oligopeptide Research Reference

fish bone collagen in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Food-Derived Peptides intermediate

Fish Bone Peptides: Oligopeptide Research Reference

Fish Bone Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Fish Collagen Peptides: Oligopeptide Research Reference

Fish Collagen Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Fish Collagen: Oligopeptide Research Reference

Fish Collagen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological acti...

Fish Peptides intermediate

Fish Gelatin: Oligopeptide Research Reference

Fish Gelatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Fish Neuropeptide: Oligopeptide Research Reference

Fish Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ...

Fish Peptides intermediate

Fish Peptide Hormone: Oligopeptide Research Reference

Fish Peptide Hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Fish Peptides intermediate

Fish Piscidin: Antimicrobial Peptide Reference

AMP from fish gill and skin providing mucosal defense against aquatic pathogens. This antimicrobial peptide demonstrates activity against pathogens and is st...

Antimicrobial Peptides intermediate

Fish Scale Peptides: Oligopeptide Research Reference

Fish Scale Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Fish Skin Peptides: Oligopeptide Research Reference

Fish Skin Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Fish Venom: Oligopeptide Research Reference

Fish Venom is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...

Fish Peptides intermediate

Flag Tag Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using Flag Tag. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

FLAG-tag → Anti-FLAG (Affinity Purification)

Comprehensive reference for FLAG-tag → Anti-FLAG (Affinity Purification), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Flatworm Parasitic / Liver Fluke

Flatworm Parasitic / Liver Fluke is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...

Worm Peptides intermediate

Flatworm Parasitic / Tapeworm: Comprehensive Peptide Refe...

Flatworm Parasitic / Tapeworm is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Worm Peptides intermediate

Flax Peptide: Oligopeptide Research Reference

A bioactive peptide derived from flax with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Flexal N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Flexal N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

flexibility Resource: Oligopeptide Research Reference

The flexibility database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Flow Chemistry Synthesis: Analytical Technique in Peptide...

A peptide synthesis method using Flow Chemistry for producing peptides with specific properties. This analytical technique provides valuable insights into pe...

Peptide Synthesis Methods advanced

Flow Chemistry Synthesis: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Flow Cytometry Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Flow Cytometry. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

Flow Cytometry for Peptides: Comprehensive Peptide Reference

Discover flow cytometry applications for peptide-MHC complex detection and peptide library screening. This peptide or oligopeptide is studied for its biologi...

Peptide Analysis intermediate

Flt3L Hormone: Endogenous Peptide Hormone Reference

Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

Flt3L Peptide Hormone: Endogenous Peptide Hormone Reference

Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

Flt3L Protein Hormone: Endogenous Peptide Hormone Reference

Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

FLU-v: Oligopeptide Research Reference

FLU-v, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

fluorescence for Peptides: Comprehensive Peptide Reference

Application of fluorescence technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...

Structural Biology Techniques advanced

Fluorescence Spectroscopy for Peptides

Learn fluorescence spectroscopy techniques for studying peptide conformation, interactions, and microenvironment changes.

Peptide Analysis intermediate

Fluorescent Labeling Synthesis

A peptide synthesis method using Fluorescent Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Fmoc Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Fmoc for producing peptides with specific properties. This analytical technique provides valuable insights into peptide stru...

Peptide Synthesis Methods advanced

FMRFamide-related Peptides (C. elegans)

Comprehensive reference for FMRFamide-related Peptides (C. elegans), a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

foam for Peptides: Analytical Technique in Peptide Research

Application of foam technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...

Structural Biology Techniques advanced

Focal-adhesion Pathway Peptide 1

A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Focal-adhesion Pathway Peptide 2

A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Focal-adhesion Pathway Peptide 3

A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Focal-adhesion Pathway Peptide 4

A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Focal-adhesion Pathway Peptide 5

A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Foldseek Resource: Oligopeptide Research Reference

The Foldseek database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Follistatin Analog: Oligopeptide Research Reference

follistatin analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Reproductive Peptides intermediate

Follistatin: Receptor Pharmacology Reference

Follistatin is a protein with important roles in biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Hormones intermediate

Food Bioactive Library food-bioactive-1

Comprehensive reference for food bioactive library food-bioactive-1, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-10

Comprehensive reference for food bioactive library food-bioactive-10, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-11

Comprehensive reference for food bioactive library food-bioactive-11, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-12

Comprehensive reference for food bioactive library food-bioactive-12, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-13

Comprehensive reference for food bioactive library food-bioactive-13, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-14

Comprehensive reference for food bioactive library food-bioactive-14, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-15

Comprehensive reference for food bioactive library food-bioactive-15, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-16

Comprehensive reference for food bioactive library food-bioactive-16, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-17

Comprehensive reference for food bioactive library food-bioactive-17, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-18

Comprehensive reference for food bioactive library food-bioactive-18, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-19

Comprehensive reference for food bioactive library food-bioactive-19, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-2

Comprehensive reference for food bioactive library food-bioactive-2, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-20

Comprehensive reference for food bioactive library food-bioactive-20, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-21

Comprehensive reference for food bioactive library food-bioactive-21, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-22

Comprehensive reference for food bioactive library food-bioactive-22, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-23

Comprehensive reference for food bioactive library food-bioactive-23, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-24

Comprehensive reference for food bioactive library food-bioactive-24, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-25

Comprehensive reference for food bioactive library food-bioactive-25, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-26

Comprehensive reference for food bioactive library food-bioactive-26, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-27

Comprehensive reference for food bioactive library food-bioactive-27, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-28

Comprehensive reference for food bioactive library food-bioactive-28, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-29

Comprehensive reference for food bioactive library food-bioactive-29, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-3

Comprehensive reference for food bioactive library food-bioactive-3, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-30

Comprehensive reference for food bioactive library food-bioactive-30, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-31

Comprehensive reference for food bioactive library food-bioactive-31, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-32

Comprehensive reference for food bioactive library food-bioactive-32, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-33

Comprehensive reference for food bioactive library food-bioactive-33, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-34

Comprehensive reference for food bioactive library food-bioactive-34, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-35

Comprehensive reference for food bioactive library food-bioactive-35, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-36

Comprehensive reference for food bioactive library food-bioactive-36, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-37

Comprehensive reference for food bioactive library food-bioactive-37, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-38

Comprehensive reference for food bioactive library food-bioactive-38, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-39

Comprehensive reference for food bioactive library food-bioactive-39, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-4

Comprehensive reference for food bioactive library food-bioactive-4, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-40

Comprehensive reference for food bioactive library food-bioactive-40, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-5

Comprehensive reference for food bioactive library food-bioactive-5, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-6

Comprehensive reference for food bioactive library food-bioactive-6, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-7

Comprehensive reference for food bioactive library food-bioactive-7, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-8

Comprehensive reference for food bioactive library food-bioactive-8, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Bioactive Library food-bioactive-9

Comprehensive reference for food bioactive library food-bioactive-9, covering molecular structure, pharmacological properties, receptor interactions,

Food-Derived Peptides intermediate

Food Preservation: Oligopeptide Research Reference

Use of antimicrobial peptides for food preservation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...

Peptide Therapeutics intermediate

FOR-026: Oligopeptide Research Reference

Long-term stability. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Peptide Manufacturing intermediate

FOR-027: Oligopeptide Research Reference

Pulmonary, amorphous. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...

Peptide Manufacturing intermediate

FOR-028: Oligopeptide Research Reference

Sustained release, targeting. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Manufacturing intermediate

FOR-029: Oligopeptide Research Reference

Membrane permeation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Peptide Manufacturing intermediate

FOR-030: Oligopeptide Research Reference

Local sustained delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Manufacturing intermediate

Formulation (5 processes): Comprehensive Peptide Reference

Comprehensive reference for Formulation (5 processes), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

FR901379: Oligopeptide Research Reference

FR901379, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Fragment Condensation: Oligopeptide Research Reference

Fragment Condensation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Fragment Molecular Orbital for Peptides

A computational method for studying peptides using Fragment Molecular Orbital. This analytical technique provides valuable insights into peptide structure, p...

Computational Methods advanced

Free Energy Perturbation for Peptides

A computational method for studying peptides using Free Energy Perturbation. This analytical technique provides valuable insights into peptide structure, pur...

Computational Methods advanced

Free PSA: Oligopeptide Research Reference

Unbound PSA. Free/total PSA ratio improves prostate cancer detection. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Freeze Drying Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Freeze Drying. This analytical technique provides valuable insights into peptide structu...

Purification Methods advanced

freeze-drying for Peptides: Comprehensive Peptide Reference

Application of freeze-drying technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its...

Structural Biology Techniques advanced

Fremanezumab: Oligopeptide Research Reference

Anti-CGRP monoclonal antibody for migraine prevention with monthly or quarterly dosing. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Drugs intermediate

FRET for Peptides: Analytical Technique in Peptide Research

Application of FRET technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...

Structural Biology Techniques advanced

Frog Skin Peptide Library: Comprehensive Peptide Reference

Library of AMPs from amphibian skin secretions for drug discovery. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...

Antimicrobial Peptides intermediate

Frog: Peptide Toxin in Pharmacology Reference

0.002 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...

Toxin Peptides intermediate

FSH Analog: Oligopeptide Research Reference

FSH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Reproductive Peptides intermediate

FSH Family Peptides: Oligopeptide Research Reference

Overview of follicle-stimulating hormone and related glycoprotein hormones in reproductive endocrinology. This peptide or oligopeptide is studied for its bio...

Peptide Families intermediate

FSH Hormone: Endogenous Peptide Hormone Reference

FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

FSH Peptide Hormone: Endogenous Peptide Hormone Reference

FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

FSH Protein Hormone: Endogenous Peptide Hormone Reference

FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

FTIR Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using FTIR. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

FTIR Spectroscopy for Peptides

Learn FTIR spectroscopy techniques for analyzing peptide secondary structure through amide bond vibrations. This peptide or oligopeptide is studied for its b...

Peptide Analysis intermediate

Fucoidan Peptides: Oligopeptide Research Reference

Fucoidan Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

fukui-function Resource: Oligopeptide Research Reference

The fukui-function database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Fumitremorgin C: Oligopeptide Research Reference

Fumitremorgin C, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Fungal Antibiotic / Antifungal

Fungal Antibiotic / Antifungal is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...

Fungal Peptides intermediate

Fungal Antibiotic / Beta-lactam

Fungal Antibiotic / Beta-lactam is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Fungal Peptides intermediate

Fungal Bioactive Peptide / ATPase Inhibitor

Fungal Bioactive Peptide / ATPase Inhibitor is a bioactive compound with applications in peptide research and therapeutics.

Fungal Peptides intermediate

Fungal Bioactive Peptide / Insecticidal

Fungal Bioactive Peptide / Insecticidal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...

Fungal Peptides intermediate

Fungal Bioactive Peptide / Ionophore

Fungal Bioactive Peptide / Ionophore is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...

Fungal Peptides intermediate

Fungal Cyclopeptide / Alkaloid

Fungal Cyclopeptide / Alkaloid is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...

Fungal Peptides intermediate

Fungal Cyclopeptide / Chemosensitizer

Fungal Cyclopeptide / Chemosensitizer is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...

Fungal Peptides intermediate

Fungal Cyclopeptide / Ionophore

Fungal Cyclopeptide / Ionophore is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Fungal Peptides intermediate

Fungal Cyclopeptide / Toxin: Comprehensive Peptide Reference

Fungal Cyclopeptide / Toxin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...

Fungal Peptides intermediate

Fungal Lipopeptide / Antifungal

Fungal Lipopeptide / Antifungal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Fungal Peptides intermediate

Fungal Peptide Toxin / Neurotoxin

Fungal Peptide Toxin / Neurotoxin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Fungal Peptides intermediate

G CSF Hormone: Endogenous Peptide Hormone Reference

G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

G CSF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting G CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

G CSF Peptide Hormone: Endogenous Peptide Hormone Reference

G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

G CSF Protein Hormone: Endogenous Peptide Hormone Reference

G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

g-kg: Oligopeptide Research Reference

High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

G-protein coupled receptor: Comprehensive Peptide Reference

Comprehensive reference for g-protein coupled receptor, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Gaba: Structure, Function, and Significance

Gamma-aminobutyric acid (GABA) is a neurotransmitter found in fermented foods that has anxiolytic and antihypertensive properties.

Food-Derived Peptides intermediate

Gaduscidin 1: Oligopeptide Research Reference

Gaduscidin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Gaduscidin 2: Oligopeptide Research Reference

Gaduscidin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Galanin-Related Peptide: Receptor Pharmacology Reference

Shorter galanin family peptide with distinct receptor selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in br...

Neuropeptides intermediate

Galanin: Neuropeptide in Neuroscience Reference

A 30-amino acid neuropeptide widely distributed in the brain and peripheral tissues, regulating appetite, pain, cognition, and neuroprotection through three ...

Neuropeptides intermediate

Galcanezumab: Oligopeptide Research Reference

Anti-CGRP monoclonal antibody for episodic and chronic migraine prevention. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Drugs intermediate

Galleria Defensin: Antimicrobial Peptide Reference

Major AMP from greater wax moth hemolymph with gram-positive bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is...

Antimicrobial Peptides intermediate

Gallidermin: Antimicrobial Peptide Reference

gallidermin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Gallinacins: Oligopeptide Research Reference

Gallinacins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Gallium Nitrate: Oligopeptide Research Reference

Metal-based therapeutic that inhibits iron-dependent enzymes and ribonucleotide reductase, used for cancer-related hypercalcemia.

Metallotherapeutics intermediate

Galpanin Peptides: Receptor Pharmacology Reference

Galanin-like peptides with distinct receptor selectivity and distribution. This neuropeptide is involved in neurological signaling and is studied for its rol...

Neuropeptides intermediate

Galsulfase: Oligopeptide Research Reference

Galsulfase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Gambierdiscus toxicus: Oligopeptide Research Reference

Persistent Na+ channel activation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Protist Peptides intermediate

Gamma Bungarotoxin: Peptide Toxin in Pharmacology Reference

gamma-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Gamma-Endorphin: Neuropeptide in Neuroscience Reference

POMC-derived opioid with potential antipsychotic-like effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides intermediate

Ganirelix: Oligopeptide Research Reference

GnRH antagonist peptide used in IVF protocols to prevent premature LH surge during controlled ovarian stimulation. Covers molecular mechanisms, biological ac...

Hormone Antagonists advanced

Garlic Allin: Oligopeptide Research Reference

garlic allin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Food-Derived Peptides intermediate

Garlic Peptide: Oligopeptide Research Reference

A bioactive peptide derived from garlic with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

gas-phase-acidity Resource: Comprehensive Peptide Reference

The gas-phase-acidity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Gastric Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Gastric Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...

Disease-Associated Peptides intermediate

Gastrin (G-17): Neuropeptide in Neuroscience Reference

Gastrin (G-17), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Gastrin 1-10: Peptide Fragment Reference

Comprehensive reference for gastrin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-13: Peptide Fragment Reference

Comprehensive reference for gastrin 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-14: Peptide Fragment Reference

Comprehensive reference for gastrin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-17: Peptide Fragment Reference

Comprehensive reference for gastrin 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-34: Peptide Fragment Reference

Comprehensive reference for gastrin 1-34 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-4: Peptide Fragment Reference

Comprehensive reference for gastrin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-6: Peptide Fragment Reference

Comprehensive reference for gastrin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 1-8: Peptide Fragment Reference

Comprehensive reference for gastrin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 10-17: Peptide Fragment Reference

Comprehensive reference for gastrin 10-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 14-17: Peptide Fragment Reference

Comprehensive reference for gastrin 14-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin 5-17: Peptide Fragment Reference

Comprehensive reference for gastrin 5-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin Hormone: Endogenous Peptide Hormone Reference

Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Gastrin pentagastrin: Endogenous Peptide Hormone Reference

Comprehensive reference for gastrin pentagastrin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin Peptide Hormone: Endogenous Peptide Hormone Refer...

Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Gastrin Protein Hormone: Endogenous Peptide Hormone Refer...

Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Gastrin tetragastrin: Endogenous Peptide Hormone Reference

Comprehensive reference for gastrin tetragastrin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin trigastrin: Endogenous Peptide Hormone Reference

Comprehensive reference for gastrin trigastrin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Gastrin-Releasing Peptide: Comprehensive Peptide Reference

A 27-amino acid neuropeptide that is the mammalian homolog of amphibian bombesin, regulating gastrin release, growth, and serving as a biomarker for small ce...

Neuropeptides intermediate

Gastrin: Oligopeptide Research Reference

A gastrointestinal hormone that stimulates gastric acid secretion and growth of the gastric mucosa, existing in multiple forms including gastrin-14, gastrin-...

Peptide Hormones intermediate

Gastroenterology: Oligopeptide Research Reference

Clinical trials for gastrointestinal diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

Gaucher Disease: Oligopeptide Research Reference

Glucocerebrosidase deficiency → glucocerebroside accumulation. Treatments: imiglucerase, eliglustat. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Gaussian Accelerated for Peptides

A computational method for studying peptides using Gaussian Accelerated. This analytical technique provides valuable insights into peptide structure, purity,...

Computational Methods advanced

GC MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using GC MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

GC-C Agonist: Oligopeptide Research Reference

GC-C Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...

Peptide Clinical Trials intermediate

GDF 11 Hormone: Endogenous Peptide Hormone Reference

GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GDF 11 Peptide Hormone: Endogenous Peptide Hormone Reference

GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GDF 11 Protein Hormone: Endogenous Peptide Hormone Reference

GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GDF 11: Endogenous Peptide Hormone Reference

GDF-11 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

GDF 8 Hormone: Endogenous Peptide Hormone Reference

GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GDF 8 Peptide Hormone: Endogenous Peptide Hormone Reference

GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GDF 8 Protein Hormone: Endogenous Peptide Hormone Reference

GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GDF 8: Endogenous Peptide Hormone Reference

GDF-8 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...

Peptide Hormones intermediate

GDNF Analog: Oligopeptide Research Reference

GDNF analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Neurological Peptides intermediate

GDNF Hormone: Endogenous Peptide Hormone Reference

GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GDNF Peptide Hormone: Endogenous Peptide Hormone Reference

GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GDNF Protein Hormone: Endogenous Peptide Hormone Reference

GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GDT-TS Resource: Oligopeptide Research Reference

The GDT-TS database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...

Databases & Resources intermediate

Gecko Cathelicidin: Oligopeptide Research Reference

Gecko Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Gecko Defensin: Oligopeptide Research Reference

Gecko Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Gecko Peptides: Oligopeptide Research Reference

Antimicrobial, Wound Healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Reptile Peptides intermediate

Gecko Serum Antimicrobial Peptide

Comprehensive reference for Gecko Serum Antimicrobial Peptide, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Gecko Serum Peptide: Oligopeptide Research Reference

Gecko Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Gecko Skin Peptide: Oligopeptide Research Reference

Gecko Skin Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Gecko Venom Peptide: Oligopeptide Research Reference

Gecko Venom Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

gel for Peptides: Analytical Technique in Peptide Research

Application of gel technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...

Structural Biology Techniques advanced

gel-electrophoresis for Peptides

Application of gel-electrophoresis technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological a...

Structural Biology Techniques advanced

Gelatin hydrolysate: Structure, Function, and Significance

Gelatin hydrolysate is a mixture of collagen-derived peptides with molecular weights of 2-5 kDa. It is used for joint health and skin elasticity.

Structural Peptides intermediate

Generative Adversarial for Peptides

A computational method for studying peptides using Generative Adversarial. This analytical technique provides valuable insights into peptide structure, purit...

Computational Methods advanced

Genitourinary Tract AMPs: Antimicrobial Peptide Reference

Antimicrobial peptides in genitourinary tract protecting against urogenital infections. This antimicrobial peptide demonstrates activity against pathogens an...

Antimicrobial Peptides intermediate

Geriatrics: Oligopeptide Research Reference

Special considerations for peptide drug use in elderly patients. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

GFAP intermediate filament: Comprehensive Peptide Reference

Comprehensive reference for gfap intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

GFLGKFLGKFLG: Oligopeptide Research Reference

Paramecium tetraurelia. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Protist Peptides intermediate

GFR Alpha 1 Agonist: Oligopeptide Research Reference

GFR alpha 1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Neurological Peptides intermediate

GHIH Hormone: Endogenous Peptide Hormone Reference

GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GHIH Peptide Hormone: Endogenous Peptide Hormone Reference

GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GHIH Protein Hormone: Endogenous Peptide Hormone Reference

GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GHK-Cu: Oligopeptide Research Reference

Glycyl-L-histidyl-L-lysine copper complex. Wound healing, anti-aging. Stimulates collagen synthesis. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Ghrelin 1-10: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-14: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-2: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-28: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-4: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-6: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 1-8: Peptide Fragment Reference

Comprehensive reference for ghrelin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 10-28: Peptide Fragment Reference

Comprehensive reference for ghrelin 10-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 4-14: Peptide Fragment Reference

Comprehensive reference for ghrelin 4-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin 8-28: Peptide Fragment Reference

Comprehensive reference for ghrelin 8-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Ghrelin Hormone: Endogenous Peptide Hormone Reference

Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Ghrelin Peptide Hormone: Endogenous Peptide Hormone Refer...

Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Ghrelin Protein Hormone: Endogenous Peptide Hormone Refer...

Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Ghrelin: Endogenous Peptide Hormone Reference

28-amino acid orexigenic hormone from the stomach that stimulates growth hormone release and appetite through GHS-R signaling.

Gastrointestinal Peptides intermediate

GHRH Analog: Oligopeptide Research Reference

GHRH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Reproductive Peptides intermediate

GHRH Hormone: Endogenous Peptide Hormone Reference

GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GHRH Peptide Hormone: Endogenous Peptide Hormone Reference

GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GHRH Protein Hormone: Endogenous Peptide Hormone Reference

GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

GICWNCKNKGQYYCQC: Oligopeptide Research Reference

Saccharomyces kluyveri. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Yeast Peptides intermediate

GICWNCRNKGQYYCQCN: Oligopeptide Research Reference

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

Gila Monster Venom Protein: Comprehensive Peptide Reference

Collection of bioactive peptides from Gila monster venom. Include exendin-4 and gilatoxin. This peptide or oligopeptide is studied for its biological activit...

Peptide Therapeutics intermediate

Ginger Gingerol Peptide: Oligopeptide Research Reference

ginger gingerol peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Food-Derived Peptides intermediate

Ginger Peptide: Oligopeptide Research Reference

A bioactive peptide derived from ginger with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Ginkbilobin: Oligopeptide Research Reference

Ginkbilobin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Ginseng Peptide: Oligopeptide Research Reference

A bioactive peptide derived from ginseng with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

GIP → DPP-4 (Substrate): Oligopeptide Research Reference

GIP → DPP-4 (Substrate), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

GIP Hormone: Endogenous Peptide Hormone Reference

GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

GIP Peptide Hormone: Endogenous Peptide Hormone Reference

GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

GIP physiology, dual agonist design, incretin combination...

GIP physiology, dual agonist design, incretin combination... is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

GIP Protein Hormone: Endogenous Peptide Hormone Reference

GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

Glacontryphan M: Peptide Toxin in Pharmacology Reference

glacontryphan-M is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for ...

Venom Peptides intermediate

Glarea lozoyensis: Oligopeptide Research Reference

Inhibits β-1,3-glucan synthase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Yeast Peptides intermediate

Glargine U300 Pharmacokinetics

Pharmacokinetic characterization of concentrated glargine 300 U/mL showing delayed absorption and constant 24-hour coverage.

Peptide Drugs advanced

Glatiramer Acetate: Oligopeptide Research Reference

Random copolymer peptide mixture that modulates immune response in multiple sclerosis, mimicking myelin basic protein. Covers molecular mechanisms, biologica...

Neurological Peptides intermediate

Glatiramer: Oligopeptide Research Reference

glatiramer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

GLCGNCKNKGQYYCQC: Oligopeptide Research Reference

Tetrahymena pyriformis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Protist Peptides intermediate

GLCNLCKNKGQYYCTCTD: Oligopeptide Research Reference

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

GLCYNCNKFGQYYCTC: Oligopeptide Research Reference

Pichia kluyveri. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...

Yeast Peptides intermediate

Gliadin: Oligopeptide Research Reference

Gliadin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Gliadorphin: Oligopeptide Research Reference

Opioid peptide derived from wheat gluten (gliadin). Sequence: Tyr-Pro-Gln-Pro-Gln. Found in gluten digests. May cross blood-brain barrier and affect neurotra...

Peptide Therapeutics intermediate

Glioblastoma Peptides: Oligopeptide Research Reference

Peptides associated with Glioblastoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Gliotoxin: Oligopeptide Research Reference

Gliotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Gliovac: Oligopeptide Research Reference

Gliovac, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Global Glargine Biosimilars: Comprehensive Peptide Reference

Review of global biosimilar insulin glargine landscape including Semglee, Abasaglar, and emerging biosimilars. This peptide or oligopeptide is studied for it...

Peptide Drugs intermediate

GloVe for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using GloVe. This analytical technique provides valuable insights into peptide structure, purity, and characteri...

Computational Methods advanced

Gloverin (Hyalophora): Oligopeptide Research Reference

Gloverin (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

GLP 1 Hormone: Endogenous Peptide Hormone Reference

GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP 1 Peptide Hormone: Endogenous Peptide Hormone Reference

GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP 1 Protein Hormone: Endogenous Peptide Hormone Reference

GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP 2 Hormone: Endogenous Peptide Hormone Reference

GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP 2 Peptide Hormone: Endogenous Peptide Hormone Reference

GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP 2 Protein Hormone: Endogenous Peptide Hormone Reference

GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

GLP-1 → GLP-1R: Oligopeptide Research Reference

GLP-1 → GLP-1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

GLP-1 Adipose Tissue Effects: Comprehensive Peptide Refer...

Effects on lipolysis, adipokine secretion, and browning of white adipose tissue. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Drugs intermediate

GLP-1 Agonist Cardiovascular Protection

Evidence for cardiovascular benefits of GLP-1 receptor agonists including reduced MACE and heart failure hospitalizations.

GLP-1 Family advanced

GLP-1 Agonist Combination Therapies

Rationale and evidence for combining GLP-1 receptor agonists with other glucose-lowering medications. This peptide or oligopeptide is studied for its biologi...

GLP-1 Family intermediate

GLP-1 Agonist Diabetes Remission

Potential for GLP-1 receptor agonists to achieve type 2 diabetes remission through beta cell preservation and weight loss.

GLP-1 Family intermediate

GLP-1 Agonist Gastric Emptying Effects

Effects of GLP-1 receptor agonists on gastric motility including delayed gastric emptying and its role in glycemic control.

GLP-1 Family intermediate

GLP-1 Agonist Gastric Safety: Comprehensive Peptide Refer...

Safety profile of GLP-1 receptor agonists regarding gastric emptying, gastroparesis, and gastrointestinal tolerability. Covers molecular mechanisms, biologic...

GLP-1 Family intermediate

GLP-1 Agonist Gastroparesis Management

Clinical management of gastroparesis-like symptoms during GLP-1 agonist therapy. This peptide or oligopeptide is studied for its biological activity, structu...

GLP-1 Family intermediate

GLP-1 Agonist Immunogenicity: Comprehensive Peptide Refer...

Immunogenicity of GLP-1 receptor agonists including anti-drug antibody formation and clinical impact. This peptide or oligopeptide is studied for its biologi...

GLP-1 Family advanced

GLP-1 Agonist Impact on Obesity Epidemiology

Impact of GLP-1 receptor agonists on obesity treatment landscape and public health implications. This peptide or oligopeptide is studied for its biological a...

GLP-1 Family intermediate

GLP-1 Agonist Market: Oligopeptide Research Reference

Market analysis for GLP-1 receptor agonists. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

GLP-1 Agonist Neuroprotective Effects

Evidence for neuroprotective and neurorestorative effects of GLP-1 receptor agonists in neurodegenerative diseases. Covers molecular mechanisms, biological a...

GLP-1 Family advanced

GLP-1 Agonist Overdose: Oligopeptide Research Reference

Excessive GLP-1 agonist dosing. Can cause severe hypoglycemia and pancreatitis. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

GLP-1 Agonist Pancreatic Effects

Effects of GLP-1 receptor agonists on pancreatic beta cell function, insulin secretion, and glucagon suppression. Covers molecular mechanisms, biological act...

GLP-1 Family intermediate

GLP-1 Agonist Pregnancy Safety

Safety considerations for GLP-1 receptor agonist use during pregnancy and current recommendations. This peptide or oligopeptide is studied for its biological...

GLP-1 Family intermediate

GLP-1 Agonist Renal Effects: Comprehensive Peptide Reference

Nephroprotective effects of GLP-1 receptor agonists including reduced albuminuria and improved renal outcomes. This peptide or oligopeptide is studied for it...

GLP-1 Family advanced

GLP-1 Agonist Weight Loss Mechanisms

Multifaceted mechanisms by which GLP-1 receptor agonists induce weight loss including central appetite suppression. Covers molecular mechanisms, biological a...

GLP-1 Family intermediate

GLP-1 Agonists in NASH/MASH Treatment

Efficacy of GLP-1 receptor agonists in nonalcoholic steatohepatitis including histological improvements. This peptide or oligopeptide is studied for its biol...

GLP-1 Family advanced

GLP-1 Albumin Binding Strategy

Fatty acid acylation strategy for albumin binding extending half-life through reduced renal clearance. This peptide or oligopeptide is studied for its biolog...

Peptide Drugs intermediate

GLP-1 analog development, semaglutide oral formulation

GLP-1 analog development, semaglutide oral formulation is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

GLP-1 and Alcohol Use: Oligopeptide Research Reference

Emerging evidence for effects on alcohol craving and potential alcohol use disorder treatment. This peptide or oligopeptide is studied for its biological act...

Peptide Drugs intermediate

GLP-1 and Alzheimers: Oligopeptide Research Reference

Investigation of effects on amyloid pathology, tau phosphorylation, and cognitive decline. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs advanced

GLP-1 and Atrial Fibrillation: Comprehensive Peptide Refe...

Investigation of effects on atrial fibrillation risk and atrial remodeling in metabolic syndrome. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs advanced

GLP-1 and CKD: Oligopeptide Research Reference

Renal outcomes data including albuminuria reduction and eGFR preservation in chronic kidney disease. This peptide or oligopeptide is studied for its biologic...

Peptide Drugs intermediate

GLP-1 and Exendin-4 Receptor Cross-Reactivity

Comparison of native GLP-1 and Gila monster exendin-4 at the GLP-1 receptor including binding differences. This peptide or oligopeptide is studied for its bi...

GLP-1 Family advanced

GLP-1 and Heart Failure: Oligopeptide Research Reference

Benefits in heart failure with preserved ejection fraction including hemodynamic improvements. This peptide or oligopeptide is studied for its biological act...

Peptide Drugs advanced

GLP-1 and NAFLD: Oligopeptide Research Reference

Clinical evidence for efficacy in nonalcoholic fatty liver disease including steatosis reduction. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs intermediate

GLP-1 and Parkinsons: Oligopeptide Research Reference

Clinical trials evaluating neuroprotection including exenatide and lixisenatide studies. This peptide or oligopeptide is studied for its biological activity,...

Peptide Drugs advanced

GLP-1 and PCOS: Oligopeptide Research Reference

Emerging use in polycystic ovary syndrome for insulin sensitization and menstrual regulation. This peptide or oligopeptide is studied for its biological acti...

Peptide Drugs intermediate

GLP-1 and Smoking Cessation: Comprehensive Peptide Reference

Investigation of effects on nicotine reward and potential adjunct for smoking cessation. This peptide or oligopeptide is studied for its biological activity,...

Peptide Drugs intermediate

GLP-1 as DPP-4 Substrate: Peptide Family Reference

Mechanism of DPP-4-mediated GLP-1 degradation and how therapeutic analogues overcome this limitation. This peptide or oligopeptide is studied for its biologi...

GLP-1 Family intermediate

GLP-1 Assay Cross-Reactivity: Comprehensive Peptide Refer...

Analytical considerations for immunoassay cross-reactivity with endogenous GLP-1 and metabolites. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs advanced

GLP-1 Bone Effects: Oligopeptide Research Reference

Skeletal effects including bone formation promotion and fracture risk reduction in diabetes. This peptide or oligopeptide is studied for its biological activ...

Peptide Drugs intermediate

GLP-1 Central Appetite Effects

Central nervous system effects of GLP-1 agonists including hypothalamic appetite suppression and reward modulation. Covers molecular mechanisms, biological a...

Peptide Drugs advanced

GLP-1 DPP-4 Resistance: Oligopeptide Research Reference

Structural modifications conferring DPP-4 resistance including Aib substitution and fatty acid acylation. This peptide or oligopeptide is studied for its bio...

Peptide Drugs intermediate

GLP-1 Fatty Acid Conjugation Strategies

Chemical conjugation of fatty acid moieties to GLP-1 peptides for albumin binding and half-life extension. This peptide or oligopeptide is studied for its bi...

GLP-1 Family advanced

GLP-1 Fusion Protein Design: Comprehensive Peptide Reference

Engineering GLP-1 Fc fusion proteins and albumin fusions for extended half-life. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Drugs advanced

GLP-1 Gastroparesis: Oligopeptide Research Reference

Evaluation of delayed gastric emptying and clinical management of GI adverse effects. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs intermediate

GLP-1 Hepatic Effects: Oligopeptide Research Reference

Hepatic effects on glucose production, lipid metabolism, and nonalcoholic fatty liver disease. This peptide or oligopeptide is studied for its biological act...

Peptide Drugs advanced

GLP-1 Hypoglycemia Risk: Oligopeptide Research Reference

Glucose-dependent mechanism providing low intrinsic hypoglycemia risk versus insulin. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs beginner

GLP-1 Immunomodulatory Effects

Immune-modulating properties including macrophage polarization and cytokine reduction. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Drugs advanced

GLP-1 Nanoparticle Delivery: Comprehensive Peptide Reference

Nanoparticle encapsulation strategies including PLGA microspheres and lipid nanoparticles. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs advanced

GLP-1 Nausea Management: Oligopeptide Research Reference

Strategies for managing nausea including dose titration, dietary modifications, and antiemetics. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs beginner

GLP-1 Nephroprotective Effects

Renal protective effects including natriuresis and glomerular hyperfiltration reduction. This peptide or oligopeptide is studied for its biological activity,...

Peptide Drugs advanced

GLP-1 Neuroprotective Effects: Comprehensive Peptide Refe...

Neuroprotective properties including neuroinflammation reduction and Alzheimer disease benefits. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs advanced

GLP-1 Oral Bioavailability: Comprehensive Peptide Reference

Strategies for oral delivery including permeation enhancers, enzyme inhibitors, and mucoadhesive formulations. This peptide or oligopeptide is studied for it...

Peptide Drugs advanced

GLP-1 Pancreatitis Risk: Oligopeptide Research Reference

Evidence examining pancreatitis risk with GLP-1 agonist therapy in type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Drugs intermediate

GLP-1 PEGylation: Oligopeptide Research Reference

PEG conjugation for extending half-life while maintaining receptor binding and activation. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs advanced

GLP-1 Perioperative: Oligopeptide Research Reference

Management during surgery including aspiration risk assessment and glycemic control strategies. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs intermediate

GLP-1 Receptor Agonist Market: Comprehensive Peptide Refe...

Market landscape and commercial analysis of GLP-1 receptor agonist drugs for diabetes and obesity. This therapeutic peptide is studied for its pharmacologica...

GLP-1 Family intermediate

GLP-1 Receptor Agonist: Oligopeptide Research Reference

GLP-1 Receptor Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Peptide Clinical Trials intermediate

GLP-1 Receptor Agonists: Oligopeptide Research Reference

GLP-1 receptor agonism, glucose-dependent insulin secretion, appetite suppression. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

GLP-1 Receptor Antagonists: Comprehensive Peptide Reference

Development of GLP-1 receptor antagonists for research tools and potential therapeutic applications in obesity. Covers molecular mechanisms, biological activ...

GLP-1 Family advanced

GLP-1 Receptor Biased Agonism: Comprehensive Peptide Refe...

Concept of biased agonism at the GLP-1 receptor where different ligands preferentially activate specific signaling pathways.

GLP-1 Family advanced

GLP-1 Receptor Selectivity and Pharmacology

Structural basis of GLP-1 receptor activation and selectivity over related incretin receptors. This peptide or oligopeptide is studied for its biological act...

GLP-1 Family advanced

GLP-1 Receptor Signaling: Oligopeptide Research Reference

Intracellular signaling cascades activated by GLP-1 receptor including cAMP, PKA, and CREB pathways. This peptide or oligopeptide is studied for its biologic...

Peptide Drugs advanced

GLP-1 Receptor Structure: Analytical Technique in Peptide...

An analysis of the GLP-1 receptor cryo-EM structure, receptor activation mechanisms, and biased signaling pathways relevant to metabolic drug development.

Peptide Analysis advanced

GLP-1 Receptor Structure: Receptor Pharmacology Reference

Crystal structure and molecular pharmacology of GLP-1 receptor activation by peptide agonists. This peptide or oligopeptide is studied for its biological act...

Peptide Drugs advanced

GLP-1 Sarcopenia: Oligopeptide Research Reference

Lean mass loss concerns during weight reduction and strategies for preserving muscle mass. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

GLP-1 Skeletal Muscle Effects: Comprehensive Peptide Refe...

Effects on glucose uptake, mitochondrial function, and insulin sensitivity in muscle. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs intermediate

GLP-1 Thyroid C-Cell Risk: Comprehensive Peptide Reference

Preclinical thyroid C-cell tumors in rodents and relevance assessment for human risk. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs advanced

GLP-1 Weight Loss Mechanism: Comprehensive Peptide Reference

Multi-organ mechanisms including central appetite suppression and peripheral energy expenditure. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs intermediate

GLP-1(7-36)amide: Peptide Family Reference

The primary bioactive form of GLP-1, a 30-amino acid peptide amide produced by intestinal L-cells. This peptide or oligopeptide is studied for its biological...

GLP-1 Family intermediate

GLP-1/GIP/Glucagon Triple Agonists

Triple incretin receptor agonists simultaneously activating GLP-1, GIP, and glucagon receptors for maximal metabolic benefit.

GLP-1 Family advanced

GLP-1/Glucagon Dual Agonists: Comprehensive Peptide Refer...

Dual receptor agonists targeting both GLP-1 and glucagon receptors for enhanced metabolic effects including weight loss and hepatoprotection.

GLP-1 Family advanced

Glucagon 1-14: Peptide Fragment Reference

Comprehensive reference for glucagon 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-15: Peptide Fragment Reference

Comprehensive reference for glucagon 1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-16: Peptide Fragment Reference

Comprehensive reference for glucagon 1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-17: Peptide Fragment Reference

Comprehensive reference for glucagon 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-18: Peptide Fragment Reference

Comprehensive reference for glucagon 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-19: Peptide Fragment Reference

Comprehensive reference for glucagon 1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-20: Peptide Fragment Reference

Comprehensive reference for glucagon 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-21: Peptide Fragment Reference

Comprehensive reference for glucagon 1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-22: Peptide Fragment Reference

Comprehensive reference for glucagon 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-23: Peptide Fragment Reference

Comprehensive reference for glucagon 1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-24: Peptide Fragment Reference

Comprehensive reference for glucagon 1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-25: Peptide Fragment Reference

Comprehensive reference for glucagon 1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-26: Peptide Fragment Reference

Comprehensive reference for glucagon 1-26 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-27: Peptide Fragment Reference

Comprehensive reference for glucagon 1-27 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-28: Peptide Fragment Reference

Comprehensive reference for glucagon 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon 1-29: Peptide Fragment Reference

Comprehensive reference for glucagon 1-29 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Glucagon Family Peptides: Oligopeptide Research Reference

Overview of glucagon family peptides including glucagon, GLP-1, GLP-2, GIP, and secretin in metabolic regulation. Covers molecular mechanisms, biological act...

Peptide Families intermediate

Glucagon Hormone: Endogenous Peptide Hormone Reference

Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Glucagon Peptide Hormone: Endogenous Peptide Hormone Refe...

Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Glucagon Protein Hormone: Endogenous Peptide Hormone Refe...

Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Glucagon-Like Peptide-1: Oligopeptide Research Reference

Glucagon-like peptide-1 (GLP-1) is a 30-amino acid incretin hormone that enhances glucose-dependent insulin secretion and serves as the basis for widely pres...

Metabolic intermediate

Glucagon: Oligopeptide Research Reference

A 29-amino acid peptide hormone from pancreatic α-cells that promotes glycogenolysis and gluconeogenesis, serving as the primary counter-regulatory hormone t...

Peptide Hormones intermediate

Glucanase Plant: Oligopeptide Research Reference

glucanase plant in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Agricultural Peptides intermediate

Glutamate Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Glutamate including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...

Amino Acid Metabolism intermediate

Glutamate Modification: Post-Translational Modification R...

Post-translational modifications of Glutamate including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...

Amino Acid Modifications intermediate

Glutamate Peptide: Oligopeptide Research Reference

Glutamate (E) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...

Amino Acid Peptides beginner

Glutamine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Glutamine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...

Amino Acid Metabolism intermediate

Glutamine Modification: Post-Translational Modification R...

Post-translational modifications of Glutamine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...

Amino Acid Modifications intermediate

Glutamine Peptide: Oligopeptide Research Reference

Glutamine (Q) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...

Amino Acid Peptides beginner

Glutathione (γ-Glu-Cys-Gly Tripeptide)

Comprehensive reference for Glutathione (γ-Glu-Cys-Gly Tripeptide), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Glutathione Oxidized: Oligopeptide Research Reference

glutathione oxidized in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Antioxidant Peptides intermediate

Glutathione Peroxidase Mimetic

glutathione peroxidase mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Antioxidant Peptides intermediate

Glutathione: The Master Antioxidant

glutathione (GSH), the most abundant tripeptide in mammalian cells, covering molecular structure, biosynthesis, redox chemistry, and clinical significance

Tripeptides intermediate

Gluten Exorphin: Oligopeptide Research Reference

Opioid peptides derived from wheat gluten. Multiple forms (glutenexorphin A5, B5, C5). May affect brain function and behavior. Potential role in gluten sensi...

Peptide Therapeutics intermediate

Glutenin: Oligopeptide Research Reference

Glutenin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Glycine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Glycine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...

Amino Acid Metabolism intermediate

Glycine Modification: Post-Translational Modification Ref...

Post-translational modifications of Glycine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...

Amino Acid Modifications intermediate

Glycine Peptide: Oligopeptide Research Reference

Glycine (G) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...

Amino Acid Peptides beginner

Glycopeptides: Oligopeptide Research Reference

Cell wall synthesis inhibition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Bacterial Peptides intermediate

Glycosidic Bonds in Glycopeptides

Explore glycosidic bond formation in glycopeptide conjugates and glycoprotein engineering. This modification affects peptide stability, receptor binding, and...

Peptide Modifications advanced

Glycosylation: Oligopeptide Research Reference

Addition of carbohydrate groups to proteins. Affects folding, stability, activity. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

GM CSF Hormone: Endogenous Peptide Hormone Reference

GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GM CSF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting GM CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide-Drug Conjugates advanced

GM CSF Peptide Hormone: Endogenous Peptide Hormone Reference

GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GM CSF Protein Hormone: Endogenous Peptide Hormone Reference

GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

GMP for Peptide Manufacturing: Comprehensive Peptide Refe...

Learn Good Manufacturing Practice requirements specific to peptide drug substance and product manufacturing facilities. Covers molecular mechanisms, biologic...

Regulatory advanced

GNCNTACGUWC: Oligopeptide Research Reference

Cylindrospermopsis raciborskii. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Protist Peptides intermediate

GnIH: Oligopeptide Research Reference

GnIH in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Reproductive Peptides intermediate

GnRH (Gonadotropin-releasing hormone)

Comprehensive reference for GnRH (Gonadotropin-releasing hormone), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

GnRH → GnRHR: Oligopeptide Research Reference

GnRH → GnRHR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

GnRH Agonist Overdose: Oligopeptide Research Reference

Excessive GnRH agonist dosing. Can cause severe hormone suppression. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Therapeutics intermediate

GnRH Agonist: Oligopeptide Research Reference

GnRH agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Reproductive Peptides intermediate

GnRH Family Peptides: Oligopeptide Research Reference

Overview of gonadotropin-releasing hormone family peptides in reproductive axis regulation. This peptide or oligopeptide is studied for its biological activi...

Peptide Families intermediate

GnRH Modulators: Oligopeptide Research Reference

GnRH receptor agonists and antagonists. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

Goblet Cell Secreted Peptide: Comprehensive Peptide Refer...

Mucin-associated antimicrobial peptide from goblet cells in mucus layer defense. This antimicrobial peptide demonstrates activity against pathogens and is st...

Antimicrobial Peptides advanced

Gold Nanoparticle Labeling Synthesis

A peptide synthesis method using Gold Nanoparticle Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its ...

Peptide Synthesis Methods advanced

Golimumab: Oligopeptide Research Reference

golimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Golodirsen: Oligopeptide Research Reference

Golodirsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Gonadotropin-Releasing Hormone

Decapeptide hypothalamic hormone controlling gonadotropin release. This neuropeptide is involved in neurological signaling and is studied for its roles in br...

Neuropeptides beginner

Goose Beta-Defensin (AcBD): Comprehensive Peptide Reference

Comprehensive reference for Goose Beta-Defensin (AcBD), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Goose Cathelicidin: Oligopeptide Research Reference

Goose Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Goose Defensin: Oligopeptide Research Reference

Goose Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Goserelin Implant Technology: Comprehensive Peptide Refer...

Biodegradable Zoladex implant technology providing sustained GnRH agonist release for hormone-dependent conditions. Covers molecular mechanisms, biological a...

Therapeutic Peptides intermediate

Goserelin Implant: Oligopeptide Research Reference

Goserelin Implant, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Goserelin: Oligopeptide Research Reference

goserelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Goserelin: Oligopeptide Research Reference

Sustained-release GnRH agonist depot for prostate cancer, endometriosis, and breast cancer. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs intermediate

GPCR-mediated mating response: Comprehensive Peptide Refe...

Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

GPI Anchors on Peptides: Post-Translational Modification ...

Guide to glycosylphosphatidylinositol anchors linking peptides to cell membranes. This modification affects peptide stability, receptor binding, and biologic...

Peptide Modifications advanced

GPT for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using GPT. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...

Computational Methods advanced

Gramicidin A: Antimicrobial Peptide Reference

Linear pentadecapeptide that forms monovalent cation channels in bacterial membranes, component of topical antimicrobial preparations.

Antimicrobial Peptides intermediate

Gramicidin A: Antimicrobial Peptide Reference

Gramicidin A is a linear 15-amino acid peptide antibiotic from Bacillus brevis that forms cation-selective ion channels in bacterial membranes.

Antimicrobial Peptides intermediate

Gramicidin D: Antimicrobial Peptide Reference

Mixture of linear pentadecapeptides from Bacillus brevis that form ion channels in bacterial membranes for topical antimicrobial use.

Antimicrobial Peptides intermediate

Gramicidin S: Antimicrobial Peptide Reference

Cyclic decapeptide antibiotic from Bacillus brevis that disrupts bacterial membranes through amphipathic beta-sheet structure.

Antimicrobial Peptides intermediate

Gramicidin S1: Antimicrobial Peptide Reference

gramicidin-S1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Gramicidin S2: Antimicrobial Peptide Reference

gramicidin-S2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Granisetron: Oligopeptide Research Reference

granisetron in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

GRANITE: Oligopeptide Research Reference

GRANITE, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Granulysin Antimicrobial: Antimicrobial Peptide Reference

Cytotoxic granule protein with direct activity against intracellular bacteria. This antimicrobial peptide demonstrates activity against pathogens and is stud...

Antimicrobial Peptides advanced

Grape Peptide: Oligopeptide Research Reference

A bioactive peptide derived from grape with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Grapefruit Peptide: Oligopeptide Research Reference

A bioactive peptide derived from grapefruit with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Plant-Derived Peptides intermediate

Green Chemistry: Oligopeptide Research Reference

Sustainable chemistry approaches to peptide synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...

Peptide Therapeutics intermediate

Green-tea Peptide: Oligopeptide Research Reference

A bioactive peptide derived from green-tea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

Growth Differentiation Factor GDF-1

Comprehensive reference for growth differentiation factor GDF-1, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-10

Comprehensive reference for growth differentiation factor GDF-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-11

Comprehensive reference for growth differentiation factor GDF-11, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-15

Comprehensive reference for growth differentiation factor GDF-15, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-16

Comprehensive reference for growth differentiation factor GDF-16, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-2

Comprehensive reference for growth differentiation factor GDF-2, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-3

Comprehensive reference for growth differentiation factor GDF-3, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-5

Comprehensive reference for growth differentiation factor GDF-5, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-6

Comprehensive reference for growth differentiation factor GDF-6, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-7

Comprehensive reference for growth differentiation factor GDF-7, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-8

Comprehensive reference for growth differentiation factor GDF-8, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Differentiation Factor GDF-9

Comprehensive reference for growth differentiation factor GDF-9, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Growth Disorders and Peptides: Comprehensive Peptide Refe...

Explore growth hormone and IGF-1 peptide therapies for treating growth hormone deficiency and dwarfism. This peptide or oligopeptide is studied for its biolo...

Peptide Therapeutics intermediate

Growth Hormone Family Peptides

Comprehensive guide to growth hormone family peptides including GH, prolactin, and placental lactogen. This peptide or oligopeptide is studied for its biolog...

Peptide Families intermediate

Growth Hormone Releasing Peptides

Synthetic hexapeptides that stimulate growth hormone release through the ghrelin receptor, distinct from GHRH pathway. Covers molecular mechanisms, biologica...

Growth Factor Peptides intermediate

Growth Hormone-Releasing Hormone

A 44-amino acid hypothalamic peptide that stimulates growth hormone secretion from the anterior pituitary via the GHRH receptor.

Neuropeptides intermediate

Growth Hormone-Releasing Hormone

Hypothalamic peptide stimulating growth hormone release from anterior pituitary. This neuropeptide is involved in neurological signaling and is studied for i...

Neuropeptides intermediate

GsAF-IV: Peptide Toxin in Pharmacology Reference

GsAF-IV, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

GSK: Oligopeptide Research Reference

Albiglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...

Peptide Patents intermediate

GsMTx 4: Peptide Toxin in Pharmacology Reference

GsMTx-4 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...

Venom Peptides intermediate

GST Tag Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using GST Tag. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

GST-tag → Glutathione (Affinity Purification)

Comprehensive reference for GST-tag → Glutathione (Affinity Purification), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

GTEx: Oligopeptide Research Reference

Genotype-Tissue Expression database for studying gene expression across tissues. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Guanarito N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Guanarito N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Vaccines advanced

Guanylate Cyclase-C Agonist: Comprehensive Peptide Reference

Guanylate Cyclase-C Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...

Peptide Clinical Trials intermediate

Guselkumab: Oligopeptide Research Reference

guselkumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Gut Disorders and Peptides: Comprehensive Peptide Reference

Explore peptide therapies for gastrointestinal conditions including IBD, Crohn's disease, and motility disorders. Covers molecular mechanisms, biological act...

Peptide Therapeutics intermediate

Gyromitrin: Oligopeptide Research Reference

Gyromitrin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

H Pylori Peptide: Oligopeptide Research Reference

A peptide associated with H Pylori for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

H-bond-network Resource: Oligopeptide Research Reference

The H-bond-network database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

HA Tag Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using HA Tag. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

HA-tag → Anti-HA (Affinity Purification)

Comprehensive reference for HA-tag → Anti-HA (Affinity Purification), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Hair Growth: Oligopeptide Research Reference

Peptide-based approaches to hair growth. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Therapeutics intermediate

Half Life Extension System 1: Comprehensive Peptide Refer...

A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...

Drug Delivery Systems advanced

Half Life Extension System 2: Comprehensive Peptide Refer...

A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...

Drug Delivery Systems advanced

Half Life Extension System 3: Comprehensive Peptide Refer...

A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...

Drug Delivery Systems advanced

Half-life extension: Oligopeptide Research Reference

Comprehensive reference for half-life extension, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Halichondrin B: Oligopeptide Research Reference

Halichondrin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Halovir A: Oligopeptide Research Reference

Halovir A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Handbook of Biologically Active Peptides

Comprehensive reference handbook covering all aspects of peptide biology. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide Therapeutics intermediate

HAT Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HAT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Hazelnut Peptide: Oligopeptide Research Reference

A bioactive peptide derived from hazelnut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

HbA1c: Oligopeptide Research Reference

HbA1c, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarkers Expanded intermediate

HBsAg Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HBsAg for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Vaccines advanced

HBsAg: Oligopeptide Research Reference

HBsAg is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity...

Peptide Vaccines intermediate

HBV HBsAg Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HBV HBsAg for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

HBV Peptide Vaccine: Oligopeptide Research Reference

HBV Peptide Vaccine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

HCAP 18: Antimicrobial Peptide Reference

hCAP-18 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

HCG Analog: Oligopeptide Research Reference

hCG analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Reproductive Peptides intermediate

HCG Hormone: Endogenous Peptide Hormone Reference

HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HCG Peptide Hormone: Endogenous Peptide Hormone Reference

HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HCG Protein Hormone: Endogenous Peptide Hormone Reference

HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HCV E1E2 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HCV E1E2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

HCV Peptide Vaccine: Oligopeptide Research Reference

HCV Peptide Vaccine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

HDAC Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HDAC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

HDM2 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HDM2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

HdTx1: Peptide Toxin in Pharmacology Reference

HdTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...

Venom Peptides intermediate

Head Neck Cancer Peptides: Comprehensive Peptide Reference

Peptides associated with Head Neck Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its ...

Disease-Associated Peptides intermediate

Head-to-Tail Cyclization: Oligopeptide Research Reference

Formation of peptide bond between N-terminal and C-terminus. Creates cyclic peptides. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Therapeutics intermediate

Health Economics of Peptide Therapeutics: Cost-Effectiven...

Analyze the economic aspects of peptide drug development, pricing, reimbursement, and patient access. This peptide or oligopeptide is studied for its biologi...

Health Economics advanced

Heart Failure and Peptides: Comprehensive Peptide Reference

Discover natriuretic peptides and other peptide therapies for managing heart failure and cardiovascular dysfunction. Covers molecular mechanisms, biological ...

Peptide Therapeutics intermediate

Heart Failure Peptides: Oligopeptide Research Reference

Peptides associated with Heart Failure including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...

Disease-Associated Peptides intermediate

Heart Failure: Oligopeptide Research Reference

Cardiac impairment syndrome. HFrEF, HFpEF, HFmrEF. Treatments: ACEi/ARB/ARNI, beta-blockers, MRA, SGLT2i, devices. Covers molecular mechanisms, biological ac...

Peptide Therapeutics intermediate

Hedgehog Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Hedgehog Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide-Drug Conjugates advanced

Hedgehog Modulator: Oligopeptide Research Reference

Hedgehog modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Signaling Peptides intermediate

Hedgehog Pathway Peptide 1: Comprehensive Peptide Reference

A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hedgehog Pathway Peptide 2: Comprehensive Peptide Reference

A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hedgehog Pathway Peptide 3: Comprehensive Peptide Reference

A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hedgehog Pathway Peptide 4: Comprehensive Peptide Reference

A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hedgehog Pathway Peptide 5: Comprehensive Peptide Reference

A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Helicase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Helicase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide-Drug Conjugates advanced

Helix Assembly System 1: Oligopeptide Research Reference

A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Helix Assembly System 2: Oligopeptide Research Reference

A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Helix Assembly System 3: Oligopeptide Research Reference

A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Helodermin: Oligopeptide Research Reference

35-aa peptide from Gila monster venom. VIP-like peptide with potent vasodilatory effects. This peptide or oligopeptide is studied for its biological activity...

Peptide Therapeutics intermediate

Helospectin I: Oligopeptide Research Reference

35-aa VIP-related peptide from Gila monster venom. Vasodilatory and secretory effects. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Therapeutics intermediate

Helospectin II: Oligopeptide Research Reference

27-aa VIP-related peptide from Gila monster venom. Similar to helospectin I but shorter. This peptide or oligopeptide is studied for its biological activity,...

Peptide Therapeutics intermediate

Hematology / TPO Mimetic: Oligopeptide Research Reference

Hematology / TPO Mimetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Therapeutic Peptides intermediate

Hematology: Oligopeptide Research Reference

Clinical trials for blood disorders. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Therapeutics intermediate

Hematotoxicity: Oligopeptide Research Reference

Blood-related adverse effects of peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Peptide Therapeutics intermediate

Hemokinin 1: Neuropeptide in Neuroscience Reference

hemokinin-1 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...

Neuropeptides intermediate

Hemostasis / Coagulation: Oligopeptide Research Reference

Hemostasis / Coagulation is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Peptide Interactions intermediate

Hemp Peptide: Oligopeptide Research Reference

A bioactive peptide derived from hemp with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Hendra F Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Hendra F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Heparin Affinity Purification: Comprehensive Peptide Refe...

A purification technique for separating and isolating peptides using Heparin Affinity. This analytical technique provides valuable insights into peptide stru...

Purification Methods advanced

Heparin: Oligopeptide Research Reference

heparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Drugs intermediate

Hepatic Impairment: Oligopeptide Research Reference

Considerations for peptide drug dosing in patients with liver disease. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Therapeutics intermediate

Hepatitis and Peptides: Oligopeptide Research Reference

Discover peptide antiviral approaches for hepatitis B and C treatment including direct-acting peptide inhibitors. Covers molecular mechanisms, biological act...

Peptide Therapeutics advanced

Hepatitis B Peptides: Oligopeptide Research Reference

Peptides associated with Hepatitis B including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Hepatitis C Peptides: Oligopeptide Research Reference

Peptides associated with Hepatitis C including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Hepatitis Peptides: Oligopeptide Research Reference

Peptides associated with Hepatitis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...

Disease-Associated Peptides intermediate

Hepatitis: Oligopeptide Research Reference

HBV/HCV liver infection. Treatments: entecavir/tenofovir (HBV), sofosbuvir (HCV). This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Hepatotoxicity: Oligopeptide Research Reference

Liver damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Therapeutics intermediate

Hepcidin 20: Endogenous Peptide Hormone Reference

hepcidin-20 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Hepcidin 22: Endogenous Peptide Hormone Reference

hepcidin-22 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Hepcidin 25: Endogenous Peptide Hormone Reference

hepcidin-25 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Hepcidin Hormone: Endogenous Peptide Hormone Reference

Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Hepcidin Peptide Hormone: Endogenous Peptide Hormone Refe...

Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Hepcidin Protein Hormone: Endogenous Peptide Hormone Refe...

Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Hepcidin: Receptor Pharmacology Reference

Hepcidin is a peptide with important roles in biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Hormones intermediate

HER2 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HER2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

HER2 Inhibitor: Oligopeptide Research Reference

HER2 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Signaling Peptides intermediate

Herpes Peptides: Oligopeptide Research Reference

Peptides associated with Herpes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Hevein: Oligopeptide Research Reference

Hevein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

HGF Hormone: Endogenous Peptide Hormone Reference

HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

HGF Peptide Hormone: Endogenous Peptide Hormone Reference

HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HGF Protein Hormone: Endogenous Peptide Hormone Reference

HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

HIC HPLC Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using HIC HPLC. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

HIC Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using HIC. This analytical technique provides valuable insights into peptide structure, purity...

Purification Methods advanced

High-performance liquid chromatography

HbA1c, small molecules. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Biomarkers Expanded intermediate

High-Throughput Screening: Comprehensive Peptide Reference

Automated testing of large peptide libraries for biological activity. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

High: Oligopeptide Research Reference

Predictions. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...

Peptide Technologies intermediate

Hippo Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hippo Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hippo Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hippo Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hippo Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Hirudin HV1: Oligopeptide Research Reference

Hirudin HV1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Hirudin HV2: Oligopeptide Research Reference

Hirudin HV2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Hirudin HV3: Oligopeptide Research Reference

Hirudin HV3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Hirudin: Oligopeptide Research Reference

65-amino acid thrombin inhibitor from medicinal leeches, the most potent natural anticoagulant with bivalent thrombin binding.

Cardiovascular Peptides intermediate

His Tag Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using His Tag. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

His-tag → Ni-NTA (Affinity Purification)

Comprehensive reference for His-tag → Ni-NTA (Affinity Purification), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Histatin 1: Antimicrobial Peptide Reference

Major salivary histatin contributing to oral mucosal defense against fungal pathogens. This antimicrobial peptide demonstrates activity against pathogens and...

Antimicrobial Peptides intermediate

Histatin 5: Antimicrobial Peptide Reference

Salivary antimicrobial peptide with potent antifungal activity against Candida albicans. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Histidine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Histidine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...

Amino Acid Metabolism intermediate

Histidine Modification: Post-Translational Modification R...

Post-translational modifications of Histidine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...

Amino Acid Modifications intermediate

Histidine Peptide: Oligopeptide Research Reference

Histidine (H) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...

Amino Acid Peptides beginner

Histone modification: Oligopeptide Research Reference

Comprehensive reference for histone modification, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Histone-Derived Peptide (Crocodilian)

Comprehensive reference for Histone-Derived Peptide (Crocodilian), a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

History of Antimicrobial Peptide Research

The discovery and development of antimicrobial peptides from defensins to clinical candidates. This antimicrobial peptide demonstrates activity against patho...

Peptide History intermediate

History of Combinatorial Peptide Libraries

The development of combinatorial chemistry for peptide library screening and drug discovery. This peptide or oligopeptide is studied for its biological activ...

Peptide History advanced

History of Insulin Discovery: Comprehensive Peptide Refer...

Tracing the discovery and development of insulin from Banting and Best to modern analogs. This endogenous peptide hormone plays important roles in physiologi...

Peptide History beginner

History of Mass Spectrometry: Comprehensive Peptide Refer...

From Thomson and Aston to modern proteomics, the evolution of mass spectrometry for peptides. This peptide or oligopeptide is studied for its biological acti...

Peptide History advanced

History of NMR Spectroscopy: Comprehensive Peptide Reference

The development of NMR spectroscopy for peptide structure determination and dynamics. This peptide or oligopeptide is studied for its biological activity, st...

Peptide History advanced

History of Peptide Biomarker Development

How peptide biomarkers were discovered and validated for clinical diagnostics. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide History intermediate

History of Peptide Clinical Development

The evolution of peptide drugs through clinical trials from insulin to modern therapeutics. This peptide or oligopeptide is studied for its biological activi...

Peptide History intermediate

History of Peptide Diagnostics

How peptide-based diagnostic assays evolved from immunoassays to modern biomarker testing. This peptide or oligopeptide is studied for its biological activit...

Peptide History intermediate

History of Peptide Drug Conjugates

The evolution of peptide-drug conjugates from early concepts to approved therapies. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide History advanced

History of Peptide Drug Delivery

The evolution of peptide delivery from injections to oral, nasal, and transdermal systems. This peptide or oligopeptide is studied for its biological activit...

Peptide History intermediate

History of Peptide Formulation Science

The development of formulation strategies for peptide stability and delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide History intermediate

History of Peptide Hormone Research

The discovery and characterization of peptide hormones from insulin to GLP-1. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide History beginner

History of Peptide Receptor Discovery

How peptide receptors were identified and characterized over the past century. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide History intermediate

History of Peptide Regulation: Comprehensive Peptide Refe...

How regulatory frameworks for peptide drugs evolved from early insulin to modern CMC guidelines. This peptide or oligopeptide is studied for its biological a...

Peptide History intermediate

History of Peptide Structure Determination

Methods used to determine peptide 3D structures from X-ray to cryo-EM. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide History advanced

History of Peptide Synthesis: Comprehensive Peptide Refer...

The evolution of peptide synthesis from early solution-phase methods to modern SPPS and automation. This peptide or oligopeptide is studied for its biologica...

Peptide History intermediate

History of Peptide Therapeutics

From insulin to modern GLP-1 agonists, the evolution of peptide drugs over a century. This peptide or oligopeptide is studied for its biological activity, st...

Peptide History beginner

History of Peptide Vaccine Development

Milestones in peptide vaccine technology from epitope mapping to neoantigen vaccines. This peptide or oligopeptide is studied for its biological activity, st...

Peptide History intermediate

History of Peptide Vaccines: Comprehensive Peptide Reference

The development of peptide-based vaccines from early epitope mapping to neoantigen approaches. This peptide or oligopeptide is studied for its biological act...

Peptide History intermediate

History of Peptide-GLP-1 Development

The journey from GLP-1 discovery to blockbuster diabetes and obesity drugs. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide History beginner

History of X-ray Crystallography

How X-ray crystallography enabled atomic-resolution peptide and protein structure determination. This peptide or oligopeptide is studied for its biological a...

Peptide History advanced

Histrelin Implant: Oligopeptide Research Reference

Histrelin Implant, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Histrelin: Oligopeptide Research Reference

Year-long subcutaneous GnRH agonist implant for central precocious puberty. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Drugs intermediate

HIV and Peptides: Oligopeptide Research Reference

Learn about peptide-based HIV therapies including fusion inhibitors and entry blockers for viral suppression. This peptide or oligopeptide is studied for its...

Peptide Therapeutics advanced

HIV Gp41 MPER Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HIV Gp41 MPER for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Vaccines advanced

HIV Gp41 MPER: Oligopeptide Research Reference

HIV-gp41-MPER is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...

Peptide Vaccines intermediate

Hiv Peptides: Oligopeptide Research Reference

Peptides associated with Hiv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...

Disease-Associated Peptides intermediate

HIV V2 Loop: Oligopeptide Research Reference

HIV-V2-loop is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ac...

Peptide Vaccines intermediate

HIV V2 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HIV V2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Vaccines advanced

HIV/AIDS: Oligopeptide Research Reference

HIV-1/2 → CD4+ T-cell depletion. Treatments: ART (NRTIs, NNRTIs, INSTIs, PIs). This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

HNTX I: Peptide Toxin in Pharmacology Reference

HNTX-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...

Venom Peptides intermediate

HNTX IV: Peptide Toxin in Pharmacology Reference

HNTX-IV is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...

Venom Peptides intermediate

Hollow Microneedle Peptide: Comprehensive Peptide Reference

Hollow microneedle devices enabling liquid peptide formulation delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Drug Delivery intermediate

HOMO-LUMO Resource: Oligopeptide Research Reference

The HOMO-LUMO database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Homocarnosine: Oligopeptide Research Reference

homocarnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Homocystinuria: Oligopeptide Research Reference

CBS deficiency. Elevated homocysteine. Treatments: B6, betaine, low-methionine diet. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Therapeutics intermediate

Homology Modeling for Peptides

A computational method for studying peptides using Homology Modeling. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Homology Modeling for Peptides

Understand homology modeling approaches for predicting peptide 3D structures from related template structures. This peptide or oligopeptide is studied for it...

Peptide Analysis intermediate

Hours: Oligopeptide Research Reference

Injection. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...

Peptide Technologies intermediate

HPLC FLD Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using HPLC FLD. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

HPLC for Peptide Purification: Comprehensive Peptide Refe...

Guide to high-performance liquid chromatography techniques for isolating and purifying synthetic peptides. This peptide or oligopeptide is studied for its bi...

Peptide Manufacturing intermediate

HPLC MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using HPLC MS. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

HPLC UV Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using HPLC UV. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

HPV L1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HPV L1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Vaccines advanced

Hpv Peptides: Oligopeptide Research Reference

Peptides associated with Hpv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...

Disease-Associated Peptides intermediate

HPV Vaccine L1: Oligopeptide Research Reference

HPV-vaccine-L1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological...

Peptide Vaccines intermediate

HRAS Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting HRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

hs-TnI: Oligopeptide Research Reference

Cardiac-specific troponin I (209 aa) measured by high-sensitivity assay. Released from damaged cardiomyocytes during myocardial injury. Normal: <0.04 ng/mL. ...

Peptide Therapeutics intermediate

hs-TnT: Oligopeptide Research Reference

Cardiac-specific troponin T (298 aa) measured by high-sensitivity assay. Released from damaged cardiomyocytes. Normal: <14 ng/L. Acute MI: >14 ng/L with rise...

Peptide Therapeutics intermediate

HSV GD Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HSV GD for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Vaccines advanced

HTLV Tax Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting HTLV Tax for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

HTRF Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using HTRF. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

Human Alpha-Defensin 1: Antimicrobial Peptide Reference

Neutrophil granule defensin with disulfide-stabilized structure for bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens...

Antimicrobial Peptides intermediate

Human Alpha-Defensin 2: Antimicrobial Peptide Reference

Neutrophil defensin with broad-spectrum bactericidal activity in phagolysosomal killing. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Human Alpha-Defensin 3: Antimicrobial Peptide Reference

Neutrophil defensin with strongest bactericidal activity and membrane disruption capability. This antimicrobial peptide demonstrates activity against pathoge...

Antimicrobial Peptides intermediate

Human Alpha-Defensin 4: Antimicrobial Peptide Reference

Neutrophil defensin with activity against intracellular pathogens including tuberculosis. This antimicrobial peptide demonstrates activity against pathogens ...

Antimicrobial Peptides intermediate

Human Alpha-Defensin 5: Antimicrobial Peptide Reference

Intestinal Paneth cell defensin maintaining gut microbiome homeostasis. This antimicrobial peptide demonstrates activity against pathogens and is studied for...

Antimicrobial Peptides intermediate

Human Alpha-Defensin 6: Antimicrobial Peptide Reference

Paneth cell defensin with synergistic antimicrobial activity with HD-5. This antimicrobial peptide demonstrates activity against pathogens and is studied for...

Antimicrobial Peptides intermediate

Human Beta-Defensin 1: Antimicrobial Peptide Reference

Constitutively expressed epithelial defensin providing innate defense at mucosal surfaces. This antimicrobial peptide demonstrates activity against pathogens...

Antimicrobial Peptides intermediate

Human Beta-Defensin 2: Antimicrobial Peptide Reference

Inducible epithelial antimicrobial peptide with potent activity against gram-negative bacteria and chemotactic properties for immune cells.

Antimicrobial Peptides intermediate

Human Beta-Defensin 2: Antimicrobial Peptide Reference

Inducible epithelial defensin upregulated by TLR activation during inflammation and infection. This antimicrobial peptide demonstrates activity against patho...

Antimicrobial Peptides intermediate

Human Beta-Defensin 3: Antimicrobial Peptide Reference

Most potent human defensin with broad-spectrum activity including MRSA and VRE, and strong immunomodulatory properties. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Human Beta-Defensin 3: Antimicrobial Peptide Reference

Potent inducible defensin with broad-spectrum activity and chemokine function recruiting immune cells. This peptide or oligopeptide is studied for its biolog...

Antimicrobial Peptides intermediate

Human Beta-Defensin 4: Antimicrobial Peptide Reference

Neutrophil-derived defensin with antimicrobial and wound healing functions at mucosal surfaces. This antimicrobial peptide demonstrates activity against path...

Antimicrobial Peptides intermediate

Human Cathelicidin hCAP18: Comprehensive Peptide Reference

Precursor protein of LL-37 with antimicrobial and immunomodulatory functions. This antimicrobial peptide demonstrates activity against pathogens and is studi...

Antimicrobial Peptides intermediate

Human Defensin 5: Antimicrobial Peptide Reference

human-defensin-5 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Human Defensin 6: Antimicrobial Peptide Reference

human-defensin-6 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Huntington's Disease: Oligopeptide Research Reference

Huntington's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neurological intermediate

Huntingtons Peptides: Oligopeptide Research Reference

Peptides associated with Huntingtons including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Huwentoxin II: Peptide Toxin in Pharmacology Reference

huwentoxin-II is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...

Venom Peptides intermediate

Huwentoxin-I: Peptide Toxin in Pharmacology Reference

Huwentoxin-I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Huwentoxin-IV: Peptide Toxin in Pharmacology Reference

Huwentoxin-IV, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Hyaluronan peptide: Structure, Function, and Significance

Hyaluronan-derived peptides have moisturizing and wound-healing properties. Low MW fragments stimulate hyaluronic acid synthesis.

Structural Peptides intermediate

Hydrocarbon Stapling System 1: Comprehensive Peptide Refe...

A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...

Drug Delivery Systems advanced

Hydrocarbon Stapling System 2: Comprehensive Peptide Refe...

A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...

Drug Delivery Systems advanced

Hydrocarbon Stapling System 3: Comprehensive Peptide Refe...

A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...

Drug Delivery Systems advanced

Hydrocarbon Stapling: Oligopeptide Research Reference

Introduction of hydrocarbon cross-links to stabilize α-helical conformation. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Therapeutics intermediate

Hydrogel encapsulation: Oligopeptide Research Reference

Comprehensive reference for hydrogel encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Hydrogel Formulation: Oligopeptide Research Reference

Hydrogel Formulation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Hydrogel Peptide Delivery: Comprehensive Peptide Reference

Hydrogel matrices for sustained local peptide delivery and tissue engineering. This peptide or oligopeptide is studied for its biological activity, structure...

Drug Delivery intermediate

Hydrogel Self Assembly System 1

A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Hydrogel Self Assembly System 2

A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Hydrogel Self Assembly System 3

A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...

Drug Delivery Systems advanced

Hydrogel System 1: Oligopeptide Research Reference

A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Hydrogel System 2: Oligopeptide Research Reference

A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Hydrogel System 3: Oligopeptide Research Reference

A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Hydrogen-Deuterium Exchange for Peptides

Explore HDX-MS techniques for mapping peptide dynamics, binding interfaces, and conformational changes. This peptide or oligopeptide is studied for its biolo...

Peptide Analysis advanced

Hydrolase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Hydrolase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide-Drug Conjugates advanced

hydrophilicity Resource: Oligopeptide Research Reference

The hydrophilicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Hydrophobic Interaction Analysis

An analytical technique for characterizing peptides using Hydrophobic Interaction. This analytical technique provides valuable insights into peptide structur...

Analytical Techniques advanced

hydrophobic-core Resource: Comprehensive Peptide Reference

The hydrophobic-core database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

hydrophobicity Resource: Oligopeptide Research Reference

The hydrophobicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Hydroxylamine Cleavage Purification

A purification technique for separating and isolating peptides using Hydroxylamine Cleavage. This analytical technique provides valuable insights into peptid...

Purification Methods advanced

Hyenain 1: Oligopeptide Research Reference

hyenain-1 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Hyenain 2: Oligopeptide Research Reference

hyenain-2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Hymenoptaecin: Antimicrobial Peptide Reference

Giant AMP from honeybee with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...

Antimicrobial Peptides intermediate

Hyp3-bradykinin: Antimicrobial Peptide Reference

Hyp3-bradykinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Hypa A: Oligopeptide Research Reference

Hypa A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Hypertension Peptides: Oligopeptide Research Reference

Peptides associated with Hypertension including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Hypertension: Oligopeptide Research Reference

Sustained BP ≥130/80. Treatments: ACEi/ARBs, CCBs, diuretics, beta-blockers. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Therapeutics intermediate

Hypocretin: Neuropeptide in Neuroscience Reference

Alternative name for orexin neuropeptides regulating sleep-wake transitions. This neuropeptide is involved in neurological signaling and is studied for its r...

Neuropeptides intermediate

Hypotensin (Polybia): Oligopeptide Research Reference

Hypotensin (Polybia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Hypothalamic releasing hormone

Hypothalamic releasing hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...

Neuropeptides intermediate

Iberiotoxin: Peptide Toxin in Pharmacology Reference

Highly selective BK potassium channel blocker from scorpion Buthus tamulus. This peptide toxin is derived from venom and studied for its pharmacological acti...

Venom Peptides intermediate

Ibotenic Acid: Oligopeptide Research Reference

Ibotenic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

ICA for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using ICA. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...

Computational Methods advanced

Icatibant: Oligopeptide Research Reference

Bradykinin B2 receptor antagonist for hereditary angioedema acute attacks. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Drugs intermediate

ICH Guidelines for Peptides: Comprehensive Peptide Reference

Explore International Council for Harmonisation guidelines applicable to peptide drug development and registration. Covers molecular mechanisms, biological a...

Regulatory advanced

ICOS Agonist: Oligopeptide Research Reference

ICOS agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

id: Oligopeptide Research Reference

sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...

Protist Peptides intermediate

IdegLira Combination: Oligopeptide Research Reference

Single-pen fixed-ratio co-formulation of ultra-long-acting degludec with liraglutide simplifying therapy. This peptide or oligopeptide is studied for its bio...

Peptide Drugs intermediate

Identity Testing: Oligopeptide Research Reference

Identity Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Idursulfase: Oligopeptide Research Reference

Idursulfase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

IE HPLC Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using IE HPLC. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

IEF Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using IEF. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

IEX (Ion Exchange Chromatography)

Comprehensive reference for IEX (Ion Exchange Chromatography), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

IEX Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using IEX. This analytical technique provides valuable insights into peptide structure, purity...

Purification Methods advanced

IFN Alpha Hormone: Endogenous Peptide Hormone Reference

IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Alpha Peptide Hormone: Comprehensive Peptide Reference

IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Alpha Protein Hormone: Comprehensive Peptide Reference

IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Beta Hormone: Endogenous Peptide Hormone Reference

IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

IFN Beta Peptide Hormone: Endogenous Peptide Hormone Refe...

IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

IFN Beta Protein Hormone: Endogenous Peptide Hormone Refe...

IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

IFN Gamma Hormone: Endogenous Peptide Hormone Reference

IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Gamma Peptide Hormone: Comprehensive Peptide Reference

IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Gamma Protein Hormone: Comprehensive Peptide Reference

IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

IFN Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IFN Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

IGF 1 Analog: Oligopeptide Research Reference

IGF 1 analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Reproductive Peptides intermediate

IGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

IGF1R Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IGF1R Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

IL 1 Hormone: Endogenous Peptide Hormone Reference

IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 1 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IL 1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

IL 1 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 1 Protein Hormone: Endogenous Peptide Hormone Reference

IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 10 Agonist: Oligopeptide Research Reference

IL 10 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Anti-inflammatory Peptides intermediate

IL 10 Hormone: Endogenous Peptide Hormone Reference

IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 10 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 10 Protein Hormone: Endogenous Peptide Hormone Reference

IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 11 Hormone: Endogenous Peptide Hormone Reference

IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 11 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 11 Protein Hormone: Endogenous Peptide Hormone Reference

IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 12 Hormone: Endogenous Peptide Hormone Reference

IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 12 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 12 Protein Hormone: Endogenous Peptide Hormone Reference

IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 13 Hormone: Endogenous Peptide Hormone Reference

IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 13 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 13 Protein Hormone: Endogenous Peptide Hormone Reference

IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 15 Hormone: Endogenous Peptide Hormone Reference

IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 15 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 15 Protein Hormone: Endogenous Peptide Hormone Reference

IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 17 Antibody: Oligopeptide Research Reference

IL 17 antibody in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Anti-inflammatory Peptides intermediate

IL 17 Hormone: Endogenous Peptide Hormone Reference

IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 17 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IL 17 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

IL 17 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 17 Protein Hormone: Endogenous Peptide Hormone Reference

IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 18 Hormone: Endogenous Peptide Hormone Reference

IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 18 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 18 Protein Hormone: Endogenous Peptide Hormone Reference

IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 1ra: Oligopeptide Research Reference

IL 1ra in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Anti-inflammatory Peptides intermediate

IL 2 Hormone: Endogenous Peptide Hormone Reference

IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 2 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 2 Protein Hormone: Endogenous Peptide Hormone Reference

IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 23 Antibody: Oligopeptide Research Reference

IL 23 antibody in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Anti-inflammatory Peptides intermediate

IL 23 Hormone: Endogenous Peptide Hormone Reference

IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 23 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 23 Protein Hormone: Endogenous Peptide Hormone Reference

IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 3 Hormone: Endogenous Peptide Hormone Reference

IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 3 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 3 Protein Hormone: Endogenous Peptide Hormone Reference

IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 33 Hormone: Endogenous Peptide Hormone Reference

IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 33 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 33 Protein Hormone: Endogenous Peptide Hormone Reference

IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

IL 4 Agonist: Oligopeptide Research Reference

IL 4 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Anti-inflammatory Peptides intermediate

IL 4 Hormone: Endogenous Peptide Hormone Reference

IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 4 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 4 Protein Hormone: Endogenous Peptide Hormone Reference

IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 5 Hormone: Endogenous Peptide Hormone Reference

IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 5 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 5 Protein Hormone: Endogenous Peptide Hormone Reference

IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 6 Hormone: Endogenous Peptide Hormone Reference

IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 6 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting IL 6 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

IL 6 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 6 Protein Hormone: Endogenous Peptide Hormone Reference

IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 6 Receptor Antagonist: Oligopeptide Research Reference

IL 6 receptor antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Anti-inflammatory Peptides intermediate

IL 7 Hormone: Endogenous Peptide Hormone Reference

IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 7 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 7 Protein Hormone: Endogenous Peptide Hormone Reference

IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 8 Hormone: Endogenous Peptide Hormone Reference

IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 8 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 8 Protein Hormone: Endogenous Peptide Hormone Reference

IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 9 Hormone: Endogenous Peptide Hormone Reference

IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 9 Peptide Hormone: Endogenous Peptide Hormone Reference

IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL 9 Protein Hormone: Endogenous Peptide Hormone Reference

IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

IL-1beta (Interleukin-1 Beta): Comprehensive Peptide Refe...

Comprehensive reference for IL-1beta (Interleukin-1 Beta), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

IL-6 (Interleukin-6): Oligopeptide Research Reference

IL-6 (Interleukin-6), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarkers Expanded intermediate

IL-8 (Interleukin-8 / CXCL8): Comprehensive Peptide Refer...

Comprehensive reference for IL-8 (Interleukin-8 / CXCL8), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Imaging Agents: Oligopeptide Research Reference

Peptide-based imaging agents for diagnostics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

imaging for Peptides: Analytical Technique in Peptide Res...

Application of imaging technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...

Structural Biology Techniques advanced

Imaging Mass Spec Analysis: Comprehensive Peptide Reference

An analytical technique for characterizing peptides using Imaging Mass Spec. This analytical technique provides valuable insights into peptide structure, pur...

Analytical Techniques advanced

IMCY-0098: Oligopeptide Research Reference

IMCY-0098, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Imipenem/Relebactam: Oligopeptide Research Reference

Imipenem/Relebactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Immunoaffinity Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Immunoaffinity. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

Immunoaffinity Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Immunoaffinity. This analytical technique provides valuable insights into peptide struct...

Purification Methods advanced

Immunogenicity: Oligopeptide Research Reference

ADA formation reducing efficacy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Safety intermediate

Immunology / T Cell Biology: Comprehensive Peptide Reference

Immunology / T Cell Biology is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...

Peptide Interactions intermediate

Immunomodulatory / Checkpoint Modulator

Immunomodulatory / Checkpoint Modulator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...

Peptide Drug Conjugates intermediate

Immunosuppressant Interactions

Drug interactions between immunosuppressant peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Therapeutics intermediate

Impatiens: Oligopeptide Research Reference

Impatiens, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Implantable Delivery: Oligopeptide Research Reference

Implantable devices for sustained peptide drug release. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Implantable Peptide Delivery: Comprehensive Peptide Refer...

Understand biodegradable implant devices for long-term controlled release of peptide therapeutics. This peptide or oligopeptide is studied for its biological...

Drug Delivery advanced

Implantable: Oligopeptide Research Reference

Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...

Peptide Technologies intermediate

Impurity Profiling for Peptides

Learn strategies for identifying, characterizing, and controlling impurities in peptide drug substances and products. Covers molecular mechanisms, biological...

Regulatory advanced

incidence Resource: Oligopeptide Research Reference

The incidence database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Indolicidin: Oligopeptide Research Reference

Indolicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Industrial: Oligopeptide Research Reference

Industrial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...

Peptide Applications intermediate

Infectious Disease / COVID-19 (Protein Subunit)

Infectious Disease / COVID-19 (Protein Subunit) is a bioactive compound with applications in peptide research and therapeutics.

Peptide Vaccines intermediate

Infectious Disease / EBV-Associated Cancer

Infectious Disease / EBV-Associated Cancer is a bioactive compound with applications in peptide research and therapeutics.

Peptide Vaccines intermediate

Infectious Disease: Oligopeptide Research Reference

Diseases caused by pathogenic microorganisms (bacteria, viruses, fungi, parasites). Treatments: antibiotics (bacterial), antivirals (viral), antifungals (fun...

Peptide Therapeutics intermediate

Infectious Diseases and Peptides

Discover antimicrobial and antiviral peptide therapeutics for combating infectious diseases and drug-resistant pathogens.

Peptide Therapeutics intermediate

Infectious: Oligopeptide Research Reference

Antimicrobial peptides, viral peptides, diagnostic markers. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...

Peptide Diseases intermediate

Inflammatory: Oligopeptide Research Reference

Infection, sepsis, autoimmune disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Biomarkers Expanded intermediate

Influenza HA Stem Vaccine: Comprehensive Peptide Reference

A peptide vaccine targeting Influenza HA Stem for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Vaccines advanced

Influenza HA Stem: Oligopeptide Research Reference

influenza-HA-stem is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologi...

Peptide Vaccines intermediate

Influenza M2e Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Influenza M2e for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Vaccines advanced

Influenza M2e: Oligopeptide Research Reference

influenza-M2e is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...

Peptide Vaccines intermediate

Influenza Peptides: Oligopeptide Research Reference

Peptides associated with Influenza including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...

Disease-Associated Peptides intermediate

Influenza: Oligopeptide Research Reference

Influenza A/B virus. Treatments: oseltamivir, baloxavir. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Inhaled Insulin Lispro: Oligopeptide Research Reference

Inhaled insulin lispro formulation for pulmonary delivery using specialized dry powder inhaler. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs advanced

Inhaled Insulin Technosphere: Comprehensive Peptide Refer...

Pulmonary insulin delivery using fumaryl diketopiperamine microparticles for rapid-onset prandial glucose control. Covers molecular mechanisms, biological ac...

Peptide Drugs advanced

Inhibin A: Oligopeptide Research Reference

inhibin A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Reproductive Peptides intermediate

Inhibin Alpha: Endogenous Peptide Hormone Reference

inhibin-alpha is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Inhibin and Activin Family Peptides

Guide to inhibin and activin peptides in TGF-beta signaling and reproductive biology. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Families advanced

Inhibin Beta A: Endogenous Peptide Hormone Reference

inhibin-beta-A is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Inhibin Beta B: Endogenous Peptide Hormone Reference

inhibin-beta-B is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

Inhibition: Oligopeptide Research Reference

Suppression of target activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Interactions intermediate

Inhibits protein synthesis, glutathione depletion

Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

Injectable Hydrogel Depot: Comprehensive Peptide Reference

Injectable hydrogels forming sustained-release depots for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Drug Delivery intermediate

Injection Site Reactions: Oligopeptide Research Reference

Local adverse reactions at peptide drug injection sites. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Inkjet Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Inkjet for producing peptides with specific properties. This analytical technique provides valuable insights into peptide st...

Peptide Synthesis Methods advanced

inkjet-printing for Peptides: Comprehensive Peptide Refer...

Application of inkjet-printing technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...

Structural Biology Techniques advanced

INS-1 (C. elegans): Oligopeptide Research Reference

INS-1 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-10 (C. elegans): Oligopeptide Research Reference

INS-10 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-2 (C. elegans): Oligopeptide Research Reference

INS-2 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-3 (C. elegans): Oligopeptide Research Reference

INS-3 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-4 (C. elegans): Oligopeptide Research Reference

INS-4 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-5 (C. elegans): Oligopeptide Research Reference

INS-5 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-6 (C. elegans): Oligopeptide Research Reference

INS-6 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-7 (C. elegans): Oligopeptide Research Reference

INS-7 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-8 (C. elegans): Oligopeptide Research Reference

INS-8 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

INS-9 (C. elegans): Oligopeptide Research Reference

INS-9 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Insect AMP Immune Induction: Comprehensive Peptide Reference

Pathogen recognition and signaling for AMP gene expression in insects. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...

Antimicrobial Peptides advanced

Insect Antimicrobial / Alpha-helical

Insect Antimicrobial / Alpha-helical is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...

Insect Peptides intermediate

Insect Antimicrobial / Glycine-rich

Insect Antimicrobial / Glycine-rich is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Insect Peptides intermediate

Insect Defensin / Antimicrobial

Insect Defensin / Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Insect Peptides intermediate

Insect Defensins: Oligopeptide Research Reference

Antimicrobial (Gram-positive). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Insect Peptides intermediate

Insect Hormone / Cardiovascular

Insect Hormone / Cardiovascular is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Insect Peptides intermediate

Insect Hormone / Development: Comprehensive Peptide Refer...

Insect Hormone / Development is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...

Insect Peptides intermediate

Insect Hormone / Reproduction: Comprehensive Peptide Refe...

Insect Hormone / Reproduction is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Insect Peptides intermediate

Insect Hormones: Oligopeptide Research Reference

Development, metabolism, homeostasis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Insect Peptides intermediate

Insomnia Peptides: Oligopeptide Research Reference

Peptides associated with Insomnia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Insulin (Human): Oligopeptide Research Reference

Natural human insulin produced by recombinant DNA technology. 51-aa heterodimer. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Insulin → Insulin Receptor (RTK Activation)

Comprehensive reference for Insulin → Insulin Receptor (RTK Activation), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Insulin → Insulin Receptor: Comprehensive Peptide Reference

Comprehensive reference for Insulin → Insulin Receptor, a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Insulin 327: Oligopeptide Research Reference

Novel long-acting insulin analog with albumin binding and receptor activation properties for once-weekly dosing. Covers molecular mechanisms, biological acti...

Peptide Drugs advanced

Insulin 70/30: Oligopeptide Research Reference

Premixed insulin combining 70% NPH and 30% regular insulin for basal-bolus coverage. This peptide or oligopeptide is studied for its biological activity, str...

Insulin Analogs beginner

Insulin A-chain ↔ B-chain (Disulfide Bonds)

Comprehensive reference for Insulin A-chain ↔ B-chain (Disulfide Bonds), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Insulin A-Chain Mutants: Peptide Family Reference

Engineered insulin A-chain variants with altered receptor binding affinity used in structure-activity studies. This peptide or oligopeptide is studied for it...

Insulin Family advanced

Insulin A-chain-1-10: Oligopeptide Research Reference

Comprehensive reference for insulin A-chain-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin A-chain-1-15: Oligopeptide Research Reference

Comprehensive reference for insulin A-chain-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin A-chain-1-20: Oligopeptide Research Reference

Comprehensive reference for insulin A-chain-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin A-chain-1-21: Oligopeptide Research Reference

Comprehensive reference for insulin A-chain-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin A-chain-8-21: Oligopeptide Research Reference

Comprehensive reference for insulin A-chain-8-21 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin A-Chain: Structure, Disulfide Architecture, and C...

An overview of the insulin A-chain, a 21-residue peptide that forms one-half of the bioactive insulin heterodimer critical for glucose homeostasis.

Peptide Hormones intermediate

Insulin Allergy Management: Comprehensive Peptide Reference

Diagnosis and treatment of insulin hypersensitivity including desensitization and formulation switching. This peptide or oligopeptide is studied for its biol...

Peptide Drugs advanced

Insulin Analogue Immunogenicity

Risk of anti-drug antibody formation against insulin analogues and clinical implications. This peptide or oligopeptide is studied for its biological activity...

Insulin Family advanced

Insulin Analogues: Endogenous Peptide Hormone Reference

Pharmacological properties and clinical applications of rapid-acting (lispro, aspart) and long-acting (glargine, degludec) insulin analogues for diabetes man...

Peptide Hormones intermediate

Insulin Antibody Syndrome: Comprehensive Peptide Reference

Rare condition of high-affinity insulin autoantibodies causing unpredictable glycemic excursions. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs advanced

Insulin Aspart Protamine: Oligopeptide Research Reference

Rapid-acting insulin aspart complexed with protamine. Intermediate-acting profile. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

Insulin Aspart: Oligopeptide Research Reference

insulin aspart in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Peptide Drugs intermediate

Insulin Aspart: Oligopeptide Research Reference

Rapid-acting insulin analog. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Therapeutics intermediate

Insulin Assay Cross-Reactivity

Analytical challenges with insulin immunoassay cross-reactivity from analogs, proinsulin, and antibody complexes. Covers molecular mechanisms, biological act...

Peptide Drugs advanced

Insulin B-Chain Mutants: Peptide Family Reference

Engineered insulin B-chain variants used to study self-association, receptor binding, and pharmacokinetic optimization. Covers molecular mechanisms, biologic...

Insulin Family advanced

Insulin B-chain-1-10: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-1-15: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-1-20: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-1-25: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-1-30: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-13-30: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-13-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-20-30: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-20-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-23-30: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-23-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-chain-8-30: Oligopeptide Research Reference

Comprehensive reference for insulin B-chain-8-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Metabolic Peptides intermediate

Insulin B-Chain: Oligopeptide Research Reference

The 30-amino acid B-chain of insulin forms the structural core of the insulin heterodimer, essential for receptor binding and glucose homeostasis.

Peptide Hormones intermediate

Insulin Biosimilars: Peptide Family Reference

Follow-on biologic insulin products demonstrating comparable safety, purity, and efficacy to reference insulin products.

Insulin Family intermediate

Insulin C-Peptide: Oligopeptide Research Reference

31-aa peptide from proinsulin. Biomarker for endogenous insulin production. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Therapeutics intermediate

Insulin Cardiovascular Outcomes

Cardiovascular safety and outcomes data for insulin analogues from large randomized controlled trials. This peptide or oligopeptide is studied for its biolog...

Insulin Family advanced

Insulin COI-316: Oligopeptide Research Reference

Ultra-long-acting insulin analog with high albumin affinity and slow receptor dissociation for weekly dosing. This peptide or oligopeptide is studied for its...

Peptide Drugs advanced

Insulin Cold Chain Management: Comprehensive Peptide Refe...

Requirements and best practices for maintaining insulin cold chain integrity from manufacturing to patient use. Covers molecular mechanisms, biological activ...

Insulin Family beginner

Insulin Degludec Aspart Combination

Dual insulin formulation combining degludec and aspart in fixed ratio for diabetes. This peptide or oligopeptide is studied for its biological activity, stru...

Insulin Analogs intermediate

Insulin Degludec Multi-Hexamer Chains

Self-assembly of insulin degludec into soluble multi-hexamer chains in subcutaneous tissue for ultra-long basal release.

Insulin Family advanced

Insulin Degludec: Oligopeptide Research Reference

insulin degludec in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Drugs intermediate

Insulin Degludec: Oligopeptide Research Reference

Ultra-long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Therapeutics intermediate

Insulin Degludec/Aspart 70:30: Comprehensive Peptide Refe...

Co-formulation of ultra-long-acting insulin degludec and rapid-acting insulin aspart for basal-bolus coverage. This peptide or oligopeptide is studied for it...

Insulin Family intermediate

Insulin Degludec/Aspart: Therapeutic Peptide Drug Profile

Premixed insulin with 70% insulin degludec (long-acting) and 30% insulin aspart (rapid-acting). Provides both basal and prandial coverage. Indication: Type 2...

Peptide Drugs intermediate

Insulin Degludec/Liraglutide: Comprehensive Peptide Refer...

Fixed-ratio degludec/liraglutide. Basal insulin plus GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Insulin Detemir: Oligopeptide Research Reference

insulin detemir in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Drugs intermediate

Insulin Detemir: Oligopeptide Research Reference

Long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Peptide Therapeutics intermediate

Insulin Efsitora Alfa: Oligopeptide Research Reference

Weekly basal insulin Fc fusion protein combining insulin efsitora with human IgG2 Fc for extended half-life. This peptide or oligopeptide is studied for its ...

Peptide Drugs advanced

Insulin Family Peptides: Oligopeptide Research Reference

Explore the insulin family of peptides including insulin, IGF-1, IGF-2, and relaxin, key regulators of metabolism and growth.

Peptide Families intermediate

Insulin Fc Fusion: Oligopeptide Research Reference

Genetically engineered insulin-Fc fusion protein utilizing neonatal Fc receptor recycling for weekly basal dosing. Covers molecular mechanisms, biological ac...

Peptide Drugs advanced

Insulin Glargine 300: Oligopeptide Research Reference

Concentrated formulation of insulin glargine providing more stable pharmacokinetic profile with less nocturnal hypoglycemia.

Insulin Analogs intermediate

Insulin Glargine Biosimilar: Comprehensive Peptide Reference

Biosimilar interchangeable form of insulin glargine with identical amino acid sequence and equivalent pharmacokinetic profile.

Peptide Drugs intermediate

Insulin Glargine Metabolites: Comprehensive Peptide Refer...

Active metabolites M1 and M2 contributing to prolonged glucose-lowering activity of insulin glargine. This peptide or oligopeptide is studied for its biologi...

Peptide Drugs advanced

Insulin Glargine Phosphate Buffer System

Acidic phosphate buffer system enabling glargine solution for injection before pH-dependent precipitation. This peptide or oligopeptide is studied for its bi...

Insulin Family advanced

Insulin Glargine U300: Therapeutic Peptide Drug Profile

Concentrated insulin glargine (300 units/mL). Slower absorption from larger subcutaneous depot. T½ ~36 hours. Flatter profile than U-100. Indication: Type 1 ...

Peptide Drugs intermediate

Insulin Glargine U500: Therapeutic Peptide Drug Profile

Highly concentrated insulin glargine (500 units/mL). 5× concentration reduces injection volume. Mimics NPH-like profile due to slower absorption. Indication:...

Peptide Drugs intermediate

Insulin Glargine: Oligopeptide Research Reference

insulin glargine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Drugs intermediate

Insulin Glargine: Oligopeptide Research Reference

Long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Peptide Therapeutics intermediate

Insulin Glargine/Lixisenatide Fixed Ratio

Fixed-ratio combination of basal insulin glargine and rapid-acting GLP-1 agonist lixisenatide. This peptide or oligopeptide is studied for its biological act...

Insulin Family intermediate

Insulin Glargine/Lixisenatide: Comprehensive Peptide Refe...

Fixed-ratio glargine/lixisenatide. Basal insulin plus prandial GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

Insulin Glulisine: Peptide Family Reference

Rapid-acting insulin analog with asparagine at B3 replaced by lysine and lysine at B29 replaced by glutamic acid for rapid absorption.

Insulin Family intermediate

Insulin Hepatic First-Pass: Comprehensive Peptide Reference

First-pass hepatic extraction of portal insulin and implications for peripheral versus portal delivery. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs advanced

Insulin Hormone: Endogenous Peptide Hormone Reference

Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Insulin Icodec: Peptide Family Reference

Once-weekly basal insulin analog with ultra-long half-life exceeding 196 hours, representing the first weekly insulin formulation.

Insulin Family advanced

Insulin in Pregnancy: Oligopeptide Research Reference

Safety considerations for insulin analog use in gestational and pregestational diabetes during pregnancy. This peptide or oligopeptide is studied for its bio...

Peptide Drugs intermediate

Insulin Injection Site Lipohypertrophy

Lipodystrophy at insulin injection sites caused by localized anabolic effects leading to erratic absorption. This peptide or oligopeptide is studied for its ...

Insulin Family intermediate

Insulin Injection Sites: Oligopeptide Research Reference

Anatomical considerations for subcutaneous injection including absorption rates from abdomen, thigh, arm, and buttock. Covers molecular mechanisms, biologica...

Peptide Drugs beginner

Insulin Like Growth Factor 1-10

Comprehensive reference for insulin like growth factor 1-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 1-20

Comprehensive reference for insulin like growth factor 1-20, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 1-30

Comprehensive reference for insulin like growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 1-40

Comprehensive reference for insulin like growth factor 1-40, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 1-60

Comprehensive reference for insulin like growth factor 1-60, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 1-70

Comprehensive reference for insulin like growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 30-70

Comprehensive reference for insulin like growth factor 30-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 40-70

Comprehensive reference for insulin like growth factor 40-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 50-70

Comprehensive reference for insulin like growth factor 50-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor 60-70

Comprehensive reference for insulin like growth factor 60-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor des-1-10

Comprehensive reference for insulin like growth factor des-1-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor des-1-3

Comprehensive reference for insulin like growth factor des-1-3, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Like Growth Factor des-1-6

Comprehensive reference for insulin like growth factor des-1-6, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Insulin Lipohypertrophy: Oligopeptide Research Reference

Pathophysiology and prevention of subcutaneous lipohypertrophy from repetitive injection at same sites. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs beginner

Insulin Lispro AABC: Oligopeptide Research Reference

Concentrated insulin lispro (U-200). Larger doses in smaller volumes. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Insulin Lispro Mix 50/50: Oligopeptide Research Reference

Premixed insulin containing 50% lispro protamine and 50% insulin lispro for balanced prandial and basal coverage. Covers molecular mechanisms, biological act...

Peptide Drugs beginner

Insulin Lispro Mix 75/25: Oligopeptide Research Reference

Premixed formulation with 75% lispro protamine intermediate-acting and 25% insulin lispro rapid-acting. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs beginner

Insulin Lispro: Oligopeptide Research Reference

insulin lispro in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Peptide Drugs intermediate

Insulin Lispro: Oligopeptide Research Reference

Rapid-acting insulin analog. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Therapeutics intermediate

Insulin Nanoparticle Encapsulation

Biodegradable nanoparticle encapsulation of insulin for oral bioavailability protection in GI tract. This peptide or oligopeptide is studied for its biologic...

Peptide Drugs advanced

Insulin NPH: Oligopeptide Research Reference

Intermediate-acting insulin with protamine suspension, providing 12-18 hours of basal coverage for twice-daily dosing. Covers molecular mechanisms, biologica...

Insulin Analogs beginner

Insulin Overdose: Oligopeptide Research Reference

Excessive insulin dosing. Can cause severe hypoglycemia, seizures, coma, and death. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Insulin PDegludec: Oligopeptide Research Reference

insulin-pDegludec is a modified insulin analog with altered pharmacokinetic properties for improved diabetes management.

Metabolic Peptides intermediate

Insulin PEGylation Technology: Comprehensive Peptide Refe...

PEG conjugation to insulin analogs for extending half-life through reduced renal clearance and proteolysis. This peptide or oligopeptide is studied for its b...

Peptide Drugs advanced

Insulin Pen Devices: Oligopeptide Research Reference

Mechanical and electronic insulin pen devices including dose memory and bluetooth connectivity. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs beginner

Insulin Peptide Hormone: Endogenous Peptide Hormone Refer...

Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Insulin Phylogenetic Evolution

Evolutionary history of insulin from ancestral peptides in invertebrates through modern mammalian insulins. This peptide or oligopeptide is studied for its b...

Insulin Family advanced

Insulin Premixed: Oligopeptide Research Reference

Combination of intermediate and rapid-acting insulin providing both basal and prandial coverage in a single injection. Covers molecular mechanisms, biologica...

Insulin Analogs beginner

Insulin Protein Hormone: Endogenous Peptide Hormone Refer...

Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Insulin Pump Diluent: Oligopeptide Research Reference

Sterile diluent solution for diluting concentrated insulin formulations for pump reservoir compatibility. This peptide or oligopeptide is studied for its bio...

Peptide Drugs beginner

Insulin Pump Infusion Sets: Comprehensive Peptide Reference

Subcutaneous catheter systems for continuous insulin delivery from external pump devices. This peptide or oligopeptide is studied for its biological activity...

Insulin Family beginner

Insulin Pump Therapy: Oligopeptide Research Reference

Continuous subcutaneous insulin infusion using rapid-acting analogs for precise basal-bolus insulin delivery. This peptide or oligopeptide is studied for its...

Insulin Delivery intermediate

Insulin Receptor Binding Kinetics

Quantitative analysis of insulin-receptor interaction including binding affinity and dissociation rates. This peptide or oligopeptide is studied for its biol...

Insulin Family advanced

Insulin Regular: Oligopeptide Research Reference

Short-acting crystalline zinc insulin for intravenous and subcutaneous use with peak effect at 2-4 hours. This peptide or oligopeptide is studied for its bio...

Peptide Drugs beginner

Insulin Renal Clearance: Oligopeptide Research Reference

Kidney-mediated insulin degradation and dosing adjustments in chronic and end-stage kidney disease. This peptide or oligopeptide is studied for its biologica...

Peptide Drugs intermediate

Insulin Smart Pump Systems: Comprehensive Peptide Reference

Closed-loop pump systems with continuous glucose monitoring for automated basal insulin delivery. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs intermediate

Insulin Storage Stability: Comprehensive Peptide Reference

Guidelines for insulin storage including refrigeration at 2-8 degrees Celsius and in-use room temperature stability. Covers molecular mechanisms, biological ...

Peptide Drugs beginner

Insulin Subcutaneous Pharmacokinetics

Factors affecting subcutaneous absorption including blood flow, capillary permeability, and concentration. This peptide or oligopeptide is studied for its bi...

Peptide Drugs intermediate

Insulin Therapy and Weight Gain

Mechanisms and clinical management of weight gain associated with insulin therapy. This peptide or oligopeptide is studied for its biological activity, struc...

Insulin Family intermediate

Insulin Titration Algorithms: Comprehensive Peptide Refer...

Algorithmic approaches to basal insulin dose titration including treat-to-target protocols. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs beginner

Insulin Transdermal Delivery: Comprehensive Peptide Refer...

Microneedle and iontophoresis technologies enabling transdermal insulin delivery across stratum corneum. This peptide or oligopeptide is studied for its biol...

Peptide Drugs advanced

Insulin U-100 Concentration Standard

Standard 100 units/mL insulin concentration used as the reference formulation for all dose calculations. This peptide or oligopeptide is studied for its biol...

Insulin Family beginner

Insulin-Related Hypoglycemia Unawareness

Condition of impaired awareness of hypoglycemia developing from recurrent insulin-induced hypoglycemic episodes. Covers molecular mechanisms, biological acti...

Insulin Family advanced

Insulin: Oligopeptide Research Reference

A 51-amino acid peptide hormone produced by pancreatic β-cells that regulates glucose metabolism, with A-chain (21 aa) and B-chain (30 aa) connected by disul...

Peptide Hormones intermediate

Integrin Pathway Peptide 1: Comprehensive Peptide Reference

A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Integrin Pathway Peptide 2: Comprehensive Peptide Reference

A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Integrin Pathway Peptide 3: Comprehensive Peptide Reference

A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Integrin Pathway Peptide 4: Comprehensive Peptide Reference

A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Integrin Pathway Peptide 5: Comprehensive Peptide Reference

A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

interface-area Resource: Oligopeptide Research Reference

The interface-area database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Interferon Alfa: Oligopeptide Research Reference

Type I interferon glycoprotein with antiviral, antiproliferative, and immunomodulatory effects for hepatitis and cancer.

Immunomodulatory Peptides intermediate

Interferon Beta: Oligopeptide Research Reference

Type I interferon for multiple sclerosis that reduces relapse rate through immunomodulatory and anti-inflammatory mechanisms.

Immunomodulatory Peptides intermediate

Interferon Gamma: Oligopeptide Research Reference

Type II interferon that activates macrophages and enhances immune function for chronic granulomatous disease and osteopetrosis.

Immunomodulatory Peptides intermediate

Interferon IFN-alpha-1: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-10: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-10, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-14: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-14, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-16: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-16, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-17: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-17, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-4: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-4, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-5: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-5, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-6: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-6, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-7: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-7, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-alpha-8: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-alpha-8, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-beta-1a: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-beta-1a, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-beta-1b: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-beta-1b, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-beta-3: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-beta-3, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-delta: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-delta, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-epsilon-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-epsilon-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-epsilon: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-epsilon, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-gamma: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-gamma, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-kappa-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-kappa-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-kappa: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-kappa, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-lambda-1: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-lambda-1, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-lambda-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-lambda-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-lambda-3: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-lambda-3, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-lambda-4: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-lambda-4, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-mu-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-mu-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-mu: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-mu, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-nu-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-nu-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-nu: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-nu, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-omega: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-omega, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-tau: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-tau, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-theta-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-theta-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-theta: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-theta, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-xi-2: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-xi-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-xi: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-xi, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interferon IFN-zeta: Oligopeptide Research Reference

Comprehensive reference for interferon IFN-zeta, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-10: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-10, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-11: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-11, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-12: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-12, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-13: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-13, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-15: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-15, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-16: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-16, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17A: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17A, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17B: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17B, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17C: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17C, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17D: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17D, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17E: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17E, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-17F: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-17F, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-18: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-18, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-19: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-19, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-1alpha: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-1alpha, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-1beta: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-1beta, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-2: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-2, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-20: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-20, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-21: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-21, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-22: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-22, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-23: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-23, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-24: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-24, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-25: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-25, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-26: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-26, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-27: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-27, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-28A: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-28A, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-28B: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-28B, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-29: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-29, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-3: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-3, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-30: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-30, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-31: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-31, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-32: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-32, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-33: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-33, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-34: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-34, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-35: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-35, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-36alpha: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-36alpha, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-36beta: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-36beta, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-36gamma: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-36gamma, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-37: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-37, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-38: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-38, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-39: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-39, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-4: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-4, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-40: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-40, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-5: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-5, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-6: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-6, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-7: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-7, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-8: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-8, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Interleukin IL-9: Oligopeptide Research Reference

Comprehensive reference for interleukin IL-9, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Intermedin: Neuropeptide in Neuroscience Reference

intermedin is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This neuropeptide is involved in neurological signaling ...

Neuropeptides intermediate

International Peptide Society: Comprehensive Peptide Refe...

Professional society for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

InterPro Resource: Oligopeptide Research Reference

The InterPro database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Intracellular targeting, mitochondrial disruption

Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Yeast Peptides intermediate

Intranasal Peptide Delivery: Comprehensive Peptide Reference

Nasal delivery systems for peptide drugs targeting CNS or systemic absorption. This peptide or oligopeptide is studied for its biological activity, structure...

Drug Delivery intermediate

Intrathecal Peptide Delivery: Comprehensive Peptide Refer...

Explore intrathecal injection methods for delivering peptides directly into the cerebrospinal fluid. This peptide or oligopeptide is studied for its biologic...

Drug Delivery advanced

Intravenous Peptide Delivery: Comprehensive Peptide Refer...

Learn about intravenous administration of peptide therapeutics for rapid systemic delivery and controlled dosing. Covers molecular mechanisms, biological act...

Drug Delivery beginner

Intrinsically Disordered System 1

A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

Intrinsically Disordered System 2

A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

Intrinsically Disordered System 3

A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

IO102/IO103: Oligopeptide Research Reference

IO102/IO103, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Iodoacetamide Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Iodoacetamide. This analytical technique provides valuable insights into peptide structu...

Purification Methods advanced

Iodoacetyl Purification: Analytical Technique in Peptide ...

A purification technique for separating and isolating peptides using Iodoacetyl. This analytical technique provides valuable insights into peptide structure,...

Purification Methods advanced

Ion channel: Oligopeptide Research Reference

Comprehensive reference for ion channel, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Ion Exchange Analysis: Analytical Technique in Peptide Re...

An analytical technique for characterizing peptides using Ion Exchange. This analytical technique provides valuable insights into peptide structure, purity, ...

Analytical Techniques advanced

Ion Mobility Spectrometry for Peptides

Discover ion mobility spectrometry for separating peptide conformers and measuring collision cross sections. This peptide or oligopeptide is studied for its ...

Peptide Analysis advanced

Ion Transport Peptide: Oligopeptide Research Reference

Ion Transport Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

ionization-potential Resource: Comprehensive Peptide Refe...

The ionization-potential database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Iontophoresis Peptide Delivery

Understand iontophoretic enhancement for transdermal peptide delivery using low-level electrical current. This peptide or oligopeptide is studied for its bio...

Drug Delivery advanced

Ipilimumab: Oligopeptide Research Reference

ipilimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

IPP: Oligopeptide Research Reference

Isoleucine-proline-proline. ACE-inhibitory tripeptide from casein. Found in fermented milk. This peptide or oligopeptide is studied for its biological activi...

Peptide Therapeutics intermediate

Irisin 1-100: Peptide Fragment Reference

Comprehensive reference for irisin 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin 1-112: Peptide Fragment Reference

Comprehensive reference for irisin 1-112 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin 1-20: Peptide Fragment Reference

Comprehensive reference for irisin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin 1-40: Peptide Fragment Reference

Comprehensive reference for irisin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin 1-60: Peptide Fragment Reference

Comprehensive reference for irisin 1-60 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin 1-80: Peptide Fragment Reference

Comprehensive reference for irisin 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin FNIPQPNFW: Endogenous Peptide Hormone Reference

Comprehensive reference for irisin FNIPQPNFW variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Irisin Hormone: Endogenous Peptide Hormone Reference

Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Irisin Peptide Hormone: Endogenous Peptide Hormone Reference

Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Irisin Protein Hormone: Endogenous Peptide Hormone Reference

Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Irisin: Structure, Function, and Significance

Irisin is a myokine released during exercise that promotes browning of white adipose tissue and increases energy expenditure.

Peptide Hormones intermediate

ISA101: Oligopeptide Research Reference

ISA101, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Isoelectric Focusing Analysis: Comprehensive Peptide Refe...

An analytical technique for characterizing peptides using Isoelectric Focusing. This analytical technique provides valuable insights into peptide structure, ...

Analytical Techniques advanced

Isoelectric Precipitation Purification

A purification technique for separating and isolating peptides using Isoelectric Precipitation. This analytical technique provides valuable insights into pep...

Purification Methods advanced

Isoleucine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Isoleucine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...

Amino Acid Metabolism intermediate

Isoleucine Modification: Post-Translational Modification ...

Post-translational modifications of Isoleucine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...

Amino Acid Modifications intermediate

Isoleucine Peptide: Oligopeptide Research Reference

Isoleucine (I) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...

Amino Acid Peptides beginner

Isomerase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Isomerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide-Drug Conjugates advanced

Isopeptide Bonds in Peptides: Comprehensive Peptide Refer...

Learn about non-canonical isopeptide bonds in peptide cross-linking and stability. This modification affects peptide stability, receptor binding, and biologi...

Peptide Modifications advanced

Isostere System 1: Oligopeptide Research Reference

A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Isostere System 2: Oligopeptide Research Reference

A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Isostere System 3: Oligopeptide Research Reference

A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Isothermal Titration Calorimetry

ITC for measuring peptide-protein binding thermodynamics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...

Peptide Therapeutics intermediate

isothermal-titration for Peptides

Application of isothermal-titration technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological ...

Structural Biology Techniques advanced

ITC Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using ITC. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

ITC for Peptide Thermodynamics

Discover isothermal titration calorimetry for measuring thermodynamic parameters of peptide-ligand interactions. Covers molecular mechanisms, biological acti...

Peptide Analysis advanced

ITC: Oligopeptide Research Reference

mg. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...

Peptide Technologies intermediate

Itovebi: Oligopeptide Research Reference

Itovebi, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

IUPHAR/BPS Guide to Pharmacology

Comprehensive guide to pharmacological targets and their ligands. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Ixazomib Oral Proteasome Inhibitor

First oral boronic acid proteasome inhibitor for multiple myeloma, enabling convenient oral chemotherapy regimens. Covers molecular mechanisms, biological ac...

Anticancer Peptides advanced

Ixazomib: Oligopeptide Research Reference

First oral proteasome inhibitor for multiple myeloma, a boronic acid that reversibly inhibits the 20S proteasome beta5 subunit.

Anticancer Peptides advanced

JAK Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting JAK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

JAK STAT Modulator: Oligopeptide Research Reference

JAK STAT modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Signaling Peptides intermediate

JAK-STAT Pathway Peptide 1: Comprehensive Peptide Reference

A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

JAK-STAT Pathway Peptide 2: Comprehensive Peptide Reference

A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

JAK-STAT Pathway Peptide 3: Comprehensive Peptide Reference

A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

JAK-STAT Pathway Peptide 4: Comprehensive Peptide Reference

A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

JAK-STAT Pathway Peptide 5: Comprehensive Peptide Reference

A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Japonicin 2: Antimicrobial Peptide Reference

japonicin-2 is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

JASCO J-1500: Oligopeptide Research Reference

Circular dichroism spectrophotometer for protein secondary structure analysis. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

JEOL ECZ Series: Oligopeptide Research Reference

NMR spectrometer for protein structure and dynamics studies. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...

Peptide Therapeutics intermediate

Jingzhaotoxin I: Peptide Toxin in Pharmacology Reference

Jingzhaotoxin-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for...

Venom Peptides intermediate

Jingzhaotoxin III: Peptide Toxin in Pharmacology Reference

Jingzhaotoxin-III is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide or oligopeptide is studied for its biolog...

Venom Peptides intermediate

Journal of Medicinal Chemistry

Premier journal for medicinal chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Journal of Peptide Science: Comprehensive Peptide Reference

Journal dedicated to peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...

Peptide Therapeutics intermediate

JSTX (Joro Spider Toxin): Peptide Toxin in Pharmacology R...

Comprehensive reference for JSTX (Joro Spider Toxin), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

Junin N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Junin N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Vaccines advanced

JzTx 14: Peptide Toxin in Pharmacology Reference

JzTx-14 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...

Venom Peptides intermediate

JzTx 5: Peptide Toxin in Pharmacology Reference

JzTx-5 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...

Venom Peptides intermediate

JzTx I: Peptide Toxin in Pharmacology Reference

JzTx-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...

Venom Peptides intermediate

K Pneumoniae Ndm Peptide: Oligopeptide Research Reference

A peptide associated with K Pneumoniae Ndm for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, str...

Microbial Peptides intermediate

K Pneumoniae Peptide: Oligopeptide Research Reference

A peptide associated with K Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...

Microbial Peptides intermediate

K9Cath: Oligopeptide Research Reference

K9Cath, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

ka Resource: Oligopeptide Research Reference

The ka database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...

Databases & Resources intermediate

Kahalalide F: Oligopeptide Research Reference

Kahalalide F, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Kalata B1: Oligopeptide Research Reference

Kalata B1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Kalata B10: Oligopeptide Research Reference

kalata-B10 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...

Plant Peptides intermediate

Kalata B2: Oligopeptide Research Reference

kalata-B2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B3: Oligopeptide Research Reference

kalata-B3 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B5: Oligopeptide Research Reference

kalata-B5 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B6: Oligopeptide Research Reference

kalata-B6 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B7: Oligopeptide Research Reference

kalata-B7 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B8: Oligopeptide Research Reference

kalata-B8 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kalata B9: Oligopeptide Research Reference

kalata-B9 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Kallidin: Oligopeptide Research Reference

kallidin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Cardiovascular Peptides intermediate

Kallikrein Inhibitor: Enzyme in Peptide Biology Reference

kallikrein inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate sp...

Enzyme Peptides intermediate

Kappa Bungarotoxin: Peptide Toxin in Pharmacology Reference

kappa-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Kappa Conotoxin PVIIA: Peptide Toxin in Pharmacology Refe...

kappa-conotoxin-PVIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its bio...

Venom Peptides intermediate

Karenia brevis: Oligopeptide Research Reference

Activates Na+ channel (site 5), persistent opening. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Protist Peptides intermediate

kd Resource: Oligopeptide Research Reference

The kd database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...

Databases & Resources intermediate

Keratin Binding Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Keratin Binding. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Keratin intermediate filament: Comprehensive Peptide Refe...

Comprehensive reference for keratin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Keratin peptide: Structure, Function, and Significance

Keratin-derived peptides contain cysteine-rich sequences that form disulfide cross-links, providing structural integrity to hair, nails, and skin.

Structural Peptides intermediate

Khan Academy Amino Acids: Oligopeptide Research Reference

Educational resource on amino acids and protein structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Peptide Therapeutics intermediate

Kidney Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Kidney Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...

Disease-Associated Peptides intermediate

Kidney Disease and Peptides: Comprehensive Peptide Reference

Learn about peptide biomarkers and therapeutic peptides for chronic kidney disease and renal fibrosis. This peptide or oligopeptide is studied for its biolog...

Peptide Therapeutics advanced

KIM 1 Peptide: Oligopeptide Research Reference

KIM 1 peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Diagnostic Peptides intermediate

Kinase Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Kinase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide-Drug Conjugates advanced

Kinase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Kinase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide-Drug Conjugates advanced

kinetics Resource: Oligopeptide Research Reference

The kinetics database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Kisspeptin 10: Oligopeptide Research Reference

kisspeptin 10 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Reproductive Peptides intermediate

Kisspeptin 54: Oligopeptide Research Reference

kisspeptin 54 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Reproductive Peptides intermediate

Kisspeptin: Neuropeptide in Neuroscience Reference

Hypothalamic neuropeptide essential for puberty onset and reproductive function. This neuropeptide is involved in neurological signaling and is studied for i...

Neuropeptides intermediate

Klotho Hormone: Endogenous Peptide Hormone Reference

Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Klotho Peptide Hormone: Endogenous Peptide Hormone Reference

Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Klotho Protein Hormone: Endogenous Peptide Hormone Reference

Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Kluyveromyces lactis: Oligopeptide Research Reference

tRNA anticodon nuclease activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Yeast Peptides intermediate

Knauer Azura: Oligopeptide Research Reference

HPLC system for analytical and preparative peptide purification. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

KNYLSLPTQSN: Oligopeptide Research Reference

Lyngbya majuscula. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...

Protist Peptides intermediate

koff Resource: Oligopeptide Research Reference

The koff database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

Kollaren: Oligopeptide Research Reference

Palmitoyl pentapeptide-4. Stimulates collagen synthesis. Anti-aging skincare. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

kon Resource: Oligopeptide Research Reference

The kon database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

KQNLNSDIKKQIEK: Oligopeptide Research Reference

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

KRAS Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting KRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

KRREILSRRPSYR: Oligopeptide Research Reference

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

Kyotophin: Structure, Function, and Significance

Kyotophin is a dipeptide with opioid-like analgesic activity found in mammalian brain. This peptide or oligopeptide is studied for its biological activity, s...

Food-Derived Peptides intermediate

Kyotorphin: Structure, Function, and Significance

Kyotorphin (L-tyrosyl-L-arginine) is a neuropeptide with analgesic activity, found in bovine brain. This peptide or oligopeptide is studied for its biologica...

Food-Derived Peptides intermediate

L Monocytogenes Peptide: Oligopeptide Research Reference

A peptide associated with L Monocytogenes for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...

Microbial Peptides intermediate

L Pneumophila Peptide: Oligopeptide Research Reference

A peptide associated with L Pneumophila for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

LA ICP MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using LA ICP MS. This analytical technique provides valuable insights into peptide structure, purity, and...

Analytical Techniques advanced

Laboratory Diagnostics: Oligopeptide Research Reference

Peptide-based laboratory diagnostic tests. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Peptide Therapeutics intermediate

Lactenin: Antimicrobial Peptide Reference

lactenin is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological a...

Antimicrobial Peptides intermediate

Lacticin: Antimicrobial Peptide Reference

lacticin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...

Antimicrobial Peptides intermediate

Lactoferrampin: Antimicrobial Peptide Reference

lactoferrampin is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Lactoferricin B: Oligopeptide Research Reference

Lactoferricin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Food Peptides intermediate

Lactoferricin: Antimicrobial Peptide Reference

Cationic antimicrobial peptide from lactoferrin with potent gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pat...

Antimicrobial Peptides intermediate

Lactoferrin Antimicrobial: Comprehensive Peptide Reference

Iron-binding glycoprotein generating antimicrobial lactoferricin fragment upon cleavage. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Lactoferrin Derivative: Antimicrobial Peptide Reference

lactoferrin-derivative is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.

Antimicrobial Peptides intermediate

Lactoferrin: Oligopeptide Research Reference

86 kDa iron-binding glycoprotein. Antimicrobial, anti-inflammatory, immunomodulatory. Found in milk, neutrophils. Covers molecular mechanisms, biological act...

Peptide Therapeutics intermediate

Lactokinin: Structure, Function, and Significance

Lactokinins are bioactive peptides from milk proteins that inhibit angiotensin-converting enzyme, reducing blood pressure.

Food-Derived Peptides intermediate

Ladder-frame polyether peptide

Karenia brevis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

LAG 3 Blocker: Oligopeptide Research Reference

LAG 3 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

Lamination Synthesis: Analytical Technique in Peptide Res...

A peptide synthesis method using Lamination for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...

Peptide Synthesis Methods advanced

Laminin peptide: Structure, Function, and Significance

YIGSR is a laminin-derived pentapeptide that promotes cell adhesion and inhibits tumor metastasis through integrin binding.

Structural Peptides intermediate

Langevin Dynamics for Peptides

A computational method for studying peptides using Langevin Dynamics. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Lanreotide Autogel: Oligopeptide Research Reference

Deep subcutaneous depot somatostatin analog for acromegaly and neuroendocrine tumors. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs intermediate

Lanreotide: Oligopeptide Research Reference

lanreotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Lanreotide: Oligopeptide Research Reference

Somatostatin analog octapeptide used for acromegaly and neuroendocrine tumors with prolonged-release formulation. Covers molecular mechanisms, biological act...

Hormone Analogs intermediate

Laronidase: Oligopeptide Research Reference

Laronidase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Laser Ablation Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Laser Ablation. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

Lassa GP Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Lassa GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Latanoprost: Oligopeptide Research Reference

Latanoprost, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Layer By Layer Synthesis: Analytical Technique in Peptide...

A peptide synthesis method using Layer By Layer for producing peptides with specific properties. This analytical technique provides valuable insights into pe...

Peptide Synthesis Methods advanced

LC MS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using LC MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

Learning and Memory Peptides: Comprehensive Peptide Refer...

Neuropeptides involved in synaptic plasticity and memory formation. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Lebocin (Bombyx): Oligopeptide Research Reference

Lebocin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Lecanemab: Oligopeptide Research Reference

Lecanemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Lectin Affinity Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Lectin Affinity. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Leech Protease Inhibitor: Oligopeptide Research Reference

Leech Protease Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Worm Peptides intermediate

Leech Thrombin Inhibitor: Oligopeptide Research Reference

Leech Thrombin Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Worm Peptides intermediate

Leek Peptide: Oligopeptide Research Reference

A bioactive peptide derived from leek with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Lefamulin: Oligopeptide Research Reference

Lefamulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Legacy: Oligopeptide Research Reference

Legacy is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Research Tools intermediate

Legumin: Oligopeptide Research Reference

Legumin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Leishmania donovani: Oligopeptide Research Reference

Lipophosphoglycan blocks phagolysosome fusion. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Protist Peptides intermediate

Leishmania GP63 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Leishmania GP63 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Vaccines advanced

Leishmania GP63: Oligopeptide Research Reference

Leishmania-GP63 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologica...

Peptide Vaccines intermediate

Lemon Peptide: Oligopeptide Research Reference

A bioactive peptide derived from lemon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Length: Neuropeptide in Neuroscience Reference

Primary Function. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential ...

Neuropeptides intermediate

Lentil Peptide: Oligopeptide Research Reference

A bioactive peptide derived from lentil with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Leptin 1-100: Peptide Fragment Reference

Comprehensive reference for leptin 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-110: Peptide Fragment Reference

Comprehensive reference for leptin 1-110 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-120: Peptide Fragment Reference

Comprehensive reference for leptin 1-120 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-130: Peptide Fragment Reference

Comprehensive reference for leptin 1-130 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-140: Peptide Fragment Reference

Comprehensive reference for leptin 1-140 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-150: Peptide Fragment Reference

Comprehensive reference for leptin 1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-20: Peptide Fragment Reference

Comprehensive reference for leptin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-30: Peptide Fragment Reference

Comprehensive reference for leptin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-40: Peptide Fragment Reference

Comprehensive reference for leptin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-50: Peptide Fragment Reference

Comprehensive reference for leptin 1-50 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-60: Peptide Fragment Reference

Comprehensive reference for leptin 1-60 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-70: Peptide Fragment Reference

Comprehensive reference for leptin 1-70 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-80: Peptide Fragment Reference

Comprehensive reference for leptin 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 1-90: Peptide Fragment Reference

Comprehensive reference for leptin 1-90 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 100-160: Peptide Fragment Reference

Comprehensive reference for leptin 100-160 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin 120-160: Peptide Fragment Reference

Comprehensive reference for leptin 120-160 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Leptin Hormone: Endogenous Peptide Hormone Reference

Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Leptin Peptide Hormone: Endogenous Peptide Hormone Reference

Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Leptin Protein Hormone: Endogenous Peptide Hormone Reference

Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

Leptin: Oligopeptide Research Reference

Leptin is a 167-amino acid hormone secreted by adipose tissue that signals energy sufficiency to the hypothalamus, suppressing appetite and regulating energy...

Peptide Hormones intermediate

Lettuce Peptide: Oligopeptide Research Reference

A bioactive peptide derived from lettuce with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Leu-enkephalin: Neuropeptide in Neuroscience Reference

Leu-enkephalin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Leucine isolation (1819), protein hydrolysis studies

Leucine isolation (1819), protein hydrolysis studies is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Leucine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Leucine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...

Amino Acid Metabolism intermediate

Leucine Modification: Post-Translational Modification Ref...

Post-translational modifications of Leucine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...

Amino Acid Modifications intermediate

Leucine Peptide: Oligopeptide Research Reference

Leucine (L) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...

Amino Acid Peptides beginner

Leucine-Enkephalin-Arg6: Neuropeptide in Neuroscience Ref...

Extended enkephalin with C-terminal arginine for increased stability. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

Leucine-Enkephalin: Neuropeptide in Neuroscience Reference

A 5-amino acid endogenous opioid peptide (Tyr-Gly-Gly-Phe-Leu) that preferentially activates delta-opioid receptors, mediating analgesia, mood regulation, an...

Neuropeptides intermediate

Leukemia Peptides: Oligopeptide Research Reference

Peptides associated with Leukemia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Leuphasyl: Oligopeptide Research Reference

Acetyl pentapeptide-18. Reduces expression wrinkles. Cosmetic peptide. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Therapeutics intermediate

Leuprolide Depot Formulation: Comprehensive Peptide Refer...

Extended-release depot microsphere formulations of leuprolide providing 1-month to 12-month sustained testosterone suppression.

Therapeutic Peptides intermediate

Leuprolide Depot: Oligopeptide Research Reference

Leuprolide Depot, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Leuprolide: Oligopeptide Research Reference

leuprolide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Leuprolide: Oligopeptide Research Reference

GnRH agonist. Prostate cancer, endometriosis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

LH Analog: Oligopeptide Research Reference

LH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Reproductive Peptides intermediate

LH Family Peptides: Oligopeptide Research Reference

Explore luteinizing hormone family peptides and their critical roles in ovulation and steroidogenesis. This peptide or oligopeptide is studied for its biolog...

Peptide Families intermediate

LH Hormone: Endogenous Peptide Hormone Reference

LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

LH Peptide Hormone: Endogenous Peptide Hormone Reference

LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

LH Protein Hormone: Endogenous Peptide Hormone Reference

LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

Liberty Blue: Oligopeptide Research Reference

Automated peptide synthesizer for microwave-assisted SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Peptide Therapeutics intermediate

Liberty Prime: Oligopeptide Research Reference

High-throughput automated peptide synthesizer for parallel synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Liberty: Oligopeptide Research Reference

Automated peptide synthesizer for standard SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

LIF Hormone: Endogenous Peptide Hormone Reference

LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

LIF Peptide Hormone: Endogenous Peptide Hormone Reference

LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

LIF Protein Hormone: Endogenous Peptide Hormone Reference

LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

Ligase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Ligase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide-Drug Conjugates advanced

Lime Peptide: Oligopeptide Research Reference

A bioactive peptide derived from lime with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Linaclotide - First-in-Human (NCT00434993)

First-in-human trial of linaclotide for IBS-C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

Linaclotide - IBS-C (NCT00765882)

Phase III trial of linaclotide for IBS-C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Peptide Therapeutics intermediate

Linzagolix: Oligopeptide Research Reference

Oral GnRH antagonist for uterine fibroids with selective estrogen suppression. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Drugs intermediate

Lionfish Venom Peptides: Oligopeptide Research Reference

Lionfish Venom Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Lipid Conjugate System 1: Oligopeptide Research Reference

A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Lipid Conjugate System 2: Oligopeptide Research Reference

A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Lipid Conjugate System 3: Oligopeptide Research Reference

A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...

Drug Delivery Systems advanced

Lipid Conjugation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Lipid Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into...

Peptide Synthesis Methods advanced

Lipoic Acid Peptide: Oligopeptide Research Reference

lipoic acid peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Antioxidant Peptides intermediate

Lipopeptides: Oligopeptide Research Reference

Membrane disruption. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Bacterial Peptides intermediate

Liposomal Delivery: Oligopeptide Research Reference

Encapsulating peptides in liposomes for targeted delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Peptide Therapeutics intermediate

Liposomal Peptide Delivery: Comprehensive Peptide Reference

Liposome encapsulation protecting peptides from degradation and enabling targeted delivery. This peptide or oligopeptide is studied for its biological activi...

Drug Delivery intermediate

Liposome encapsulation: Oligopeptide Research Reference

Comprehensive reference for liposome encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Liposome Formulation: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Formulation intermediate

Liposome System 1: Oligopeptide Research Reference

A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Liposome System 2: Oligopeptide Research Reference

A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Liposome System 3: Oligopeptide Research Reference

A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Lipoxin A4: Oligopeptide Research Reference

lipoxin A4 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Anti-inflammatory Peptides intermediate

Liquid chromatography-mass spectrometry

Vitamin D, drug monitoring. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Biomarkers Expanded intermediate

Liquid Phase Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Liquid Phase for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

liquid-crystal for Peptides: Comprehensive Peptide Reference

Application of liquid-crystal technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Liraglutide - SCALE (NCT01272219)

SCALE trial of liraglutide for obesity management. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Therapeutics intermediate

Liraglutide 3.0mg Obesity: Comprehensive Peptide Reference

Liraglutide 3.0mg daily for chronic weight management with BMI 30 or BMI 27 with comorbidities. This peptide or oligopeptide is studied for its biological ac...

Peptide Drugs intermediate

Liraglutide for diabetes (2010), GLP-1 physiology

Liraglutide for diabetes (2010), GLP-1 physiology is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Liraglutide: Oligopeptide Research Reference

liraglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Liraglutide: Oligopeptide Research Reference

GLP-1 agonist. Type 2 diabetes and obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Peptide Therapeutics intermediate

Lisinopril: Oligopeptide Research Reference

Lisinopril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Lispro Pump Cartridge: Oligopeptide Research Reference

Preservative-free insulin lispro formulated for pump cartridges with stability at 37 degrees Celsius for 48 hours. Covers molecular mechanisms, biological ac...

Peptide Drugs beginner

Lithographic Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Lithographic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

lithography for Peptides: Analytical Technique in Peptide...

Application of lithography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...

Structural Biology Techniques advanced

Litorin: Antimicrobial Peptide Reference

Litorin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Littorin: Structure, Function, and Significance

Littorin is an antimicrobial peptide from the periwinkle snail with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...

Antimicrobial Peptides intermediate

Liver Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Liver Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Liver Cancer: Oligopeptide Research Reference

Hepatocellular carcinoma. Most common primary liver cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...

Peptide Therapeutics intermediate

Liver Disease and Peptides: Comprehensive Peptide Reference

Discover hepatoprotective peptides and antifibrotic peptide therapies for liver cirrhosis and fatty liver disease. Covers molecular mechanisms, biological ac...

Peptide Therapeutics advanced

Lixisenatide Once Daily: Peptide Family Reference

Short-acting GLP-1 receptor agonist with rapid onset and short duration, primarily targeting postprandial glucose excursions.

GLP-1 Family intermediate

Lixisenatide: Oligopeptide Research Reference

Short-acting GLP-1 receptor agonist derived from exendin-4 for once-daily postprandial glucose control in type 2 diabetes.

GLP-1 Analogs intermediate

Lixisenatide: Oligopeptide Research Reference

Once-daily short-acting GLP-1 agonist from exendin-4 with C-terminal truncation for rapid onset. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs intermediate

Lixisenatide/Insulin Glargine: Comprehensive Peptide Refe...

Fixed-ratio combination for type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

Lizard Cathelicidin: Oligopeptide Research Reference

Lizard Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Lizard Defensin: Oligopeptide Research Reference

Lizard Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Lizard Peptides: Oligopeptide Research Reference

Diabetes (GLP-1R), Antimicrobial, Vasodilation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Reptile Peptides intermediate

Lizard Venom Kallikrein: Oligopeptide Research Reference

Lizard Venom Kallikrein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

LKLCGFNFTDGKAVNGKQKWCQ: Oligopeptide Research Reference

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

LL-37 Engineered Derivatives: Comprehensive Peptide Refer...

Engineered LL-37 derivatives with enhanced activity and reduced cytotoxicity. This antimicrobial peptide demonstrates activity against pathogens and is studi...

Antimicrobial Peptides advanced

LL-37: Antimicrobial Peptide Reference

Only human cathelicidin antimicrobial peptide, providing broad-spectrum defense and immunomodulatory functions at mucosal surfaces.

Antimicrobial Peptides intermediate

LL-37: Antimicrobial Peptide Reference

LL-37 is the only human cathelicidin antimicrobial peptide, derived from hCAP18, with broad-spectrum activity against bacteria, viruses, and fungi plus immun...

Antimicrobial Peptides advanced

LNPSLYD: Oligopeptide Research Reference

Semi-synthetic. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Yeast Peptides intermediate

Locked nucleic acid: Oligopeptide Research Reference

Comprehensive reference for locked nucleic acid, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Lofentanil Long-Acting: Neuropeptide in Neuroscience Refe...

Extremely potent long-acting synthetic opioid analog. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function,...

Neuropeptides intermediate

Lonapegsomatropin: Oligopeptide Research Reference

PEGylated growth hormone prodrug releasing somatropin for once-weekly pediatric treatment. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

Long noncoding RNA: Oligopeptide Research Reference

Comprehensive reference for long noncoding rna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Long-Acting Formulations: Oligopeptide Research Reference

Strategies for extending peptide drug half-life. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

Loop Assembly System 1: Oligopeptide Research Reference

A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Loop Assembly System 2: Oligopeptide Research Reference

A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Loop Assembly System 3: Oligopeptide Research Reference

A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

LPPS (Liquid Phase Peptide Synthesis)

Comprehensive reference for LPPS (Liquid Phase Peptide Synthesis), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Lucensomycin: Oligopeptide Research Reference

Lucensomycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Lumbricin I: Oligopeptide Research Reference

Lumbricin I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Lumbricin II: Oligopeptide Research Reference

Lumbricin II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Lumbricus terrestris Lysozyme: Comprehensive Peptide Refe...

Comprehensive reference for Lumbricus terrestris Lysozyme, a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Luminescine: Oligopeptide Research Reference

Peptide that enhances skin radiance. Brightening skincare ingredient. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Therapeutics intermediate

Lunasin: Oligopeptide Research Reference

Lunasin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Lung Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Lung Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Lung Cancer: Oligopeptide Research Reference

NSCLC (85%): adenocarcinoma, squamous cell, large cell. SCLC (15%): aggressive neuroendocrine. Molecular targets: EGFR, ALK, ROS1, BRAF, KRAS G12C, MET, RET,...

Peptide Therapeutics intermediate

Lung Disease and Peptides: Comprehensive Peptide Reference

Explore peptide therapies for respiratory conditions including COPD, asthma, and pulmonary fibrosis. This peptide or oligopeptide is studied for its biologic...

Peptide Therapeutics intermediate

Lupus Peptides: Oligopeptide Research Reference

Peptides associated with Lupus including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ...

Disease-Associated Peptides intermediate

Luspatercept - Anemia (NCT02631070)

Trial of luspatercept for anemia in myelodysplastic syndromes. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Luspatercept: Oligopeptide Research Reference

TGF-β superfamily ligand trap. Stimulates erythropoiesis. FDA-approved for MDS. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

Luteinizing Hormone: Oligopeptide Research Reference

luteinizing hormone in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Drugs intermediate

Lyase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Lyase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide-Drug Conjugates advanced

Lymphoma Peptides: Oligopeptide Research Reference

Peptides associated with Lymphoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Lyngbya majuscula: Oligopeptide Research Reference

Activates protein kinase C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Protist Peptides intermediate

lyophilization for Peptides: Comprehensive Peptide Reference

Application of lyophilization technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Lyophilization Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Lyophilization. This analytical technique provides valuable insights into peptide struct...

Purification Methods advanced

Lyophilization: Oligopeptide Research Reference

Lyophilization, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Lypressin: Oligopeptide Research Reference

Lypressin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Lys49 PLA2: Peptide Toxin in Pharmacology Reference

Lys49-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

Lysine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Lysine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...

Amino Acid Metabolism intermediate

Lysine Modification: Post-Translational Modification Refe...

Post-translational modifications of Lysine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...

Amino Acid Modifications intermediate

Lysine Peptide: Oligopeptide Research Reference

Lysine (K) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...

Amino Acid Peptides beginner

M Catarrhalis Peptide: Oligopeptide Research Reference

A peptide associated with M Catarrhalis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

M CSF Hormone: Endogenous Peptide Hormone Reference

M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

M CSF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting M CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

M CSF Peptide Hormone: Endogenous Peptide Hormone Reference

M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

M CSF Protein Hormone: Endogenous Peptide Hormone Reference

M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

M Pneumoniae Peptide: Oligopeptide Research Reference

A peptide associated with M Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...

Microbial Peptides intermediate

M Tuberculosis Peptide: Oligopeptide Research Reference

A peptide associated with M Tuberculosis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struc...

Microbial Peptides intermediate

Mabinlin: Oligopeptide Research Reference

mabinlin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Agricultural Peptides intermediate

Macadamia Peptide: Oligopeptide Research Reference

A bioactive peptide derived from macadamia with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

Machine Learning for Peptides: Comprehensive Peptide Refe...

Machine learning approaches for peptide property prediction, design, and optimization. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Future advanced

Machupo N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Machupo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

Macrolactamization Synthesis: Comprehensive Peptide Refer...

A peptide synthesis method using Macrolactamization for producing peptides with specific properties. This analytical technique provides valuable insights int...

Peptide Synthesis Methods advanced

MAG1-Pokeweed: Oligopeptide Research Reference

MAG1-Pokeweed, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Magainin 1: Antimicrobial Peptide Reference

Frog skin AMP from Xenopus laevis forming voltage-dependent ion channels in bacterial membranes. This antimicrobial peptide demonstrates activity against pat...

Antimicrobial Peptides intermediate

Magainin 2: Antimicrobial Peptide Reference

Amphibian antimicrobial peptide from Xenopus laevis skin that pioneered the field of host defense peptides. This peptide or oligopeptide is studied for its b...

Antimicrobial Peptides beginner

Magainin 2: Antimicrobial Peptide Reference

Amphipathic alpha-helical AMP from African clawed frog with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pa...

Antimicrobial Peptides intermediate

Magainin: Antimicrobial Peptide Reference

A family of antimicrobial peptides from African clawed frog skin with broad-spectrum activity against bacteria, fungi, and viruses, acting through membrane d...

Antimicrobial Peptides intermediate

Magnetic Nanoparticle Labeling Synthesis

A peptide synthesis method using Magnetic Nanoparticle Labeling for producing peptides with specific properties. Covers molecular mechanisms, biological acti...

Peptide Synthesis Methods advanced

Magnetic Separation Purification

A purification technique for separating and isolating peptides using Magnetic Separation. This analytical technique provides valuable insights into peptide s...

Purification Methods advanced

Maitotoxin: Oligopeptide Research Reference

Maitotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Malaria CSP Repeat: Oligopeptide Research Reference

Malaria-CSP-repeat is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biolog...

Peptide Vaccines intermediate

Malaria CSP Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Malaria CSP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Vaccines advanced

Malaria Peptides: Oligopeptide Research Reference

Peptides associated with Malaria including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Malaria PfSPZ: Oligopeptide Research Reference

Malaria-PfSPZ is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...

Peptide Vaccines intermediate

Malaria: Oligopeptide Research Reference

Plasmodium parasite. Treatments: ACT, chloroquine, primaquine. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

MALDI for Peptides: Analytical Technique in Peptide Research

Understand MALDI mass spectrometry ionization techniques for peptide molecular weight determination and imaging. Covers molecular mechanisms, biological acti...

Peptide Analysis intermediate

MALDI Imaging Analysis: Analytical Technique in Peptide R...

An analytical technique for characterizing peptides using MALDI Imaging. This analytical technique provides valuable insights into peptide structure, purity,...

Analytical Techniques advanced

Maleimide Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using Maleimide. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

Mambin 1: Peptide Toxin in Pharmacology Reference

mambin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

Mambin 2: Peptide Toxin in Pharmacology Reference

mambin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

Mambin: Structure, Function, and Significance

Mambins are neurotoxic peptides from mamba venom with unique potassium channel blocking properties. This peptide toxin is derived from venom and studied for ...

Venom Peptides intermediate

Mammalian Neuropeptide: Oligopeptide Research Reference

Mammalian Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Mammalian Peptides intermediate

Mango Peptide: Oligopeptide Research Reference

A bioactive peptide derived from mango with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

MAP 34: Antimicrobial Peptide Reference

MAP-34 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...

Antimicrobial Peptides intermediate

MAP 36: Antimicrobial Peptide Reference

MAP-36 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...

Antimicrobial Peptides intermediate

MAP 37: Antimicrobial Peptide Reference

MAP-37 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...

Antimicrobial Peptides intermediate

MAP Kinase Modulator: Oligopeptide Research Reference

MAP kinase modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Signaling Peptides intermediate

MAPK Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

MAPK Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

MAPK Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

MAPK Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

MAPK Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Maple Syrup Urine Disease: Comprehensive Peptide Reference

Inborn error of metabolism. Branched-chain α-ketoacid dehydrogenase deficiency. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

Marburg GP Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Marburg GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide Vaccines advanced

Maresin 1: Oligopeptide Research Reference

maresin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Anti-inflammatory Peptides intermediate

Margatoxin: Peptide Toxin in Pharmacology Reference

Margatoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Marine Anti-Cancer Agent: Oligopeptide Research Reference

Marine Anti-Cancer Agent is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Marine Peptides intermediate

Marine Anti-Cancer Drug (Approved)

Marine Anti-Cancer Drug (Approved) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ac...

Marine Peptides intermediate

Marine Anti-Cancer Peptide: Comprehensive Peptide Reference

Marine Anti-Cancer Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...

Marine Peptides intermediate

Marine Anti-Inflammatory / Analgesic

Marine Anti-Inflammatory / Analgesic is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...

Marine Peptides intermediate

Marine Anti-Inflammatory / Neuroprotective

Marine Anti-Inflammatory / Neuroprotective is a bioactive compound with applications in peptide research and therapeutics.

Marine Peptides intermediate

Marine Cosmetic Peptide: Oligopeptide Research Reference

Marine Cosmetic Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...

Marine Peptides intermediate

Marine Organism AMPs: Antimicrobial Peptide Reference

AMPs from marine invertebrates and vertebrates for antibiotic discovery. This antimicrobial peptide demonstrates activity against pathogens and is studied fo...

Antimicrobial Peptides intermediate

Marine Peptide Drug Candidates

Overview of marine-derived peptides in clinical development including anticancer, antiviral, and anti-inflammatory agents.

Marine Peptides intermediate

Marine Peptide Drug: Oligopeptide Research Reference

Marine Peptide Drug is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Marine Peptides intermediate

Marine Toxin / Analgesic: Oligopeptide Research Reference

Marine Toxin / Analgesic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Marine Peptides intermediate

Marine Toxin: Oligopeptide Research Reference

Marine Toxin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...

Marine Peptides intermediate

Marine Venoms: Peptide Toxin in Pharmacology Reference

K+, Nav. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in research a...

Venom Peptides intermediate

Marine-Inspired Drug (Approved)

Marine-Inspired Drug (Approved) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Marine Peptides intermediate

Market: Oligopeptide Research Reference

Medium-High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...

Peptide Future intermediate

Markov State for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Markov State. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Computational Methods advanced

Martini for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using Martini. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

Mass Spec ESI Analysis: Analytical Technique in Peptide R...

An analytical technique for characterizing peptides using Mass Spec ESI. This analytical technique provides valuable insights into peptide structure, purity,...

Analytical Techniques advanced

Mass Spec MALDI Analysis: Analytical Technique in Peptide...

An analytical technique for characterizing peptides using Mass Spec MALDI. This analytical technique provides valuable insights into peptide structure, purit...

Analytical Techniques advanced

Mass Spec Orbitrap Analysis: Comprehensive Peptide Reference

An analytical technique for characterizing peptides using Mass Spec Orbitrap. This analytical technique provides valuable insights into peptide structure, pu...

Analytical Techniques advanced

Mass Spec QTOF Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Mass Spec QTOF. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

Mass Spec TOF Analysis: Analytical Technique in Peptide R...

An analytical technique for characterizing peptides using Mass Spec TOF. This analytical technique provides valuable insights into peptide structure, purity,...

Analytical Techniques advanced

Mass Spectrometry (MS): Analytical Technique in Peptide R...

>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...

Peptide Analysis intermediate

Mass Spectrometry for Peptides

Learn how mass spectrometry identifies and characterizes peptides through molecular weight determination and sequence analysis.

Peptide Analysis intermediate

Mass Spectrometry: Oligopeptide Research Reference

Mass Spectrometry, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

mass-spectrometry for Peptides

Application of mass-spectrometry technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological act...

Structural Biology Techniques advanced

Mast cell degranulating: Structure, Function, and Signifi...

Mast cell degranulating peptide (MCDP) from bee venom triggers histamine release from mast cells through a non-IgE mechanism.

Venom Peptides intermediate

Mastoparan (Vespula): Oligopeptide Research Reference

Mastoparan (Vespula), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Mastoparan: Antimicrobial Peptide Reference

Honeybee venom amphipathic peptide activating G-proteins and forming membrane pores. This antimicrobial peptide demonstrates activity against pathogens and i...

Antimicrobial Peptides intermediate

Mating type signaling pheromone

Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

Matrixyl 3000: Oligopeptide Research Reference

Combination of palmitoyl tripeptide-1 (Pal-Gly-Pro-Gln) and palmitoyl tetrapeptide-7 (Pal-Gly-Gln-Pro-Arg). Synergistic stimulation of collagen I, III, IV, f...

Peptide Therapeutics intermediate

Matrixyl: Oligopeptide Research Reference

Palmitoyl pentapeptide-4. Stimulates collagen synthesis. Anti-wrinkle skincare peptide. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Therapeutics intermediate

Maurotoxin: Peptide Toxin in Pharmacology Reference

Maurotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Maximin 3: Antimicrobial Peptide Reference

Maximin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Maximin 4: Antimicrobial Peptide Reference

Maximin 4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Maximin 5: Antimicrobial Peptide Reference

Maximin 5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

maximum-tolerated-dose Resource

The maximum-tolerated-dose database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Mazdutide: Oligopeptide Research Reference

Mazdutide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

MBP Tag Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using MBP Tag. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

MCC Resource: Oligopeptide Research Reference

The MCC database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

MCoTI-I/II: Oligopeptide Research Reference

MCoTI-I/II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

MDM2 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting MDM2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

MDM2/MDMX Inhibitor: Oligopeptide Research Reference

MDM2/MDMX Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Peptide Clinical Trials intermediate

MDMSTLADDLAC: Oligopeptide Research Reference

Nodularia spumigena. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Protist Peptides intermediate

Mechanochemical Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Mechanochemical for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Mediates cytoadherence to host endothelium

Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Protist Peptides intermediate

Mediates receptor binding and endocytosis

Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

Medium-High: Oligopeptide Research Reference

Structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...

Peptide Technologies intermediate

Medium: Oligopeptide Research Reference

Binding mode. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Peptide Technologies intermediate

MEK Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting MEK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

MEK Inhibitor: Oligopeptide Research Reference

MEK inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

Melanin-Concentrating Hormone: Comprehensive Peptide Refe...

Hypothalamic neuropeptide promoting feeding and energy conservation. This neuropeptide is involved in neurological signaling and is studied for its roles in ...

Neuropeptides intermediate

Melanin-Concentrating Hormone: Comprehensive Peptide Refe...

A 19-amino acid cyclic neuropeptide from the lateral hypothalamus that stimulates feeding and energy storage, with MCHR1 as a potential anti-obesity drug target

Neuropeptides intermediate

Melanocortin Family Peptides: Comprehensive Peptide Refer...

Learn about alpha-MSH, beta-MSH, and ACTH in pigmentation, energy balance, and inflammation. This peptide or oligopeptide is studied for its biological activ...

Peptide Families intermediate

Melanoma Peptides: Oligopeptide Research Reference

Peptides associated with Melanoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Melanostatin: Structure, Function, and Significance

Melanostatin (MSH release-inhibiting factor) is a tripeptide that inhibits melanocyte-stimulating hormone release. Covers molecular mechanisms, biological ac...

Food-Derived Peptides intermediate

Melanostatine: Oligopeptide Research Reference

Peptide that inhibits melanin production. Skin lightening cosmetic. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Melittin (Apis): Oligopeptide Research Reference

Melittin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Melittin: Antimicrobial Peptide Reference

Major component of bee venom that potently disrupts cell membranes, studied for antimicrobial and anticancer applications.

Antimicrobial Peptides intermediate

Melittin: Peptide Toxin in Pharmacology Reference

A 26-amino acid cytolytic peptide comprising 40-50% of honeybee (Apis mellifera) venom, with potent membrane-disrupting activity and anti-inflammatory proper...

Venom Peptides intermediate

Melon Peptide: Oligopeptide Research Reference

A bioactive peptide derived from melon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Membrane disruption, binds phosphatidylserine

Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Yeast Peptides intermediate

Membrane Filtration (Tangential Flow Filtration)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Membrane Filtration: Oligopeptide Research Reference

Membrane Filtration, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Membrane permeabilization: Comprehensive Peptide Reference

Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Yeast Peptides intermediate

Membrane pore formation: Oligopeptide Research Reference

Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

Membrane Selectivity AMPs: Comprehensive Peptide Reference

Structural basis for selectivity for bacterial over host cell membranes. This antimicrobial peptide demonstrates activity against pathogens and is studied fo...

Antimicrobial Peptides advanced

Membrane Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Membrane for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...

Peptide Synthesis Methods advanced

MenB FHbp Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting MenB FHbp for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

MenB FHbp: Oligopeptide Research Reference

MenB-fHbp is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...

Peptide Vaccines intermediate

MenB NadA Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting MenB NadA for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

MenB NadA: Oligopeptide Research Reference

MenB-NadA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...

Peptide Vaccines intermediate

MenB NHba Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting MenB NHba for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

MenB NHBA: Oligopeptide Research Reference

MenB-NHBA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...

Peptide Vaccines intermediate

Meningococcal PorA: Oligopeptide Research Reference

meningococcal-PorA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biolog...

Peptide Vaccines intermediate

Meropenem/Vaborbactam: Oligopeptide Research Reference

Meropenem/Vaborbactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Merrifield and Solid-Phase Synthesis

Bruce Merrifield's revolutionary invention of solid-phase peptide synthesis in 1963. This peptide or oligopeptide is studied for its biological activity, str...

Peptide History intermediate

Met-Enkephalin-Arg6-Gly7: Neuropeptide in Neuroscience Re...

Extended enkephalin from proenkephalin processing. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, be...

Neuropeptides intermediate

Met-enkephalin: Neuropeptide in Neuroscience Reference

Met-enkephalin is an endogenous pentapeptide opioid that modulates pain perception and stress responses through delta-opioid receptor activation.

Neuropeptides intermediate

Metabolic / Amylin Analog: Comprehensive Peptide Reference

Metabolic / Amylin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...

Therapeutic Peptides intermediate

Metabolic / Biguanide (peptide combination partner)

Metabolic / Biguanide (peptide combination partner) is a bioactive compound with applications in peptide research and therapeutics.

Therapeutic Peptides Expanded intermediate

Metabolic / Dual Incretin Agonist

Metabolic / Dual Incretin Agonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Therapeutic Peptides intermediate

Metabolic / Enzyme Inhibition: Comprehensive Peptide Refe...

Metabolic / Enzyme Inhibition is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Peptide Interactions intermediate

Metabolic / GLP-1 Agonist: Comprehensive Peptide Reference

Metabolic / GLP-1 Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...

Peptide Analogs intermediate

Metabolic / Incretin Mimetic: Comprehensive Peptide Refer...

Metabolic / Incretin Mimetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...

Therapeutic Peptides intermediate

Metabolic / Rapid-Acting Insulin

Metabolic / Rapid-Acting Insulin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...

Peptide Analogs intermediate

Metabolic / Rapid-Acting Insulin Analog

Metabolic / Rapid-Acting Insulin Analog is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...

Therapeutic Peptides Expanded intermediate

Metabolic / Ultra-Long-Acting Insulin

Metabolic / Ultra-Long-Acting Insulin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...

Peptide Analogs intermediate

Metabolic Diseases: Oligopeptide Research Reference

Disorders of metabolism: diabetes, obesity, lipid disorders, inborn errors of metabolism (PKU, Gaucher's, Fabry's). Treatments: dietary modification, enzyme ...

Peptide Therapeutics intermediate

Metabolic Signaling: Oligopeptide Research Reference

Metabolic Signaling is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Peptide Interactions intermediate

Metabolic Syndrome and Peptides

Discover peptide approaches to metabolic syndrome including insulin sensitizers and lipid-modulating peptides. This peptide or oligopeptide is studied for it...

Peptide Therapeutics intermediate

Metabolic Syndrome Peptides: Comprehensive Peptide Reference

Peptides associated with Metabolic Syndrome including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...

Disease-Associated Peptides intermediate

Metabolic Syndrome: Oligopeptide Research Reference

Cluster: obesity, dyslipidemia, hyperglycemia, hypertension. Requires ≥3 of 5 criteria. Treatments: lifestyle modification, metformin, statins.

Peptide Therapeutics intermediate

Metabolic: Oligopeptide Research Reference

Diabetes management, bone metabolism. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Biomarkers Expanded intermediate

Metadynamics for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Metadynamics. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Computational Methods advanced

Metal Affinity Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Metal Affinity. This analytical technique provides valuable insights into peptide struct...

Purification Methods advanced

Metal Chelation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Metal Chelation for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Metalloprotease cleaves complement C3b to iC3b

Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Protist Peptides intermediate

Metformin: Oligopeptide Research Reference

Biguanide oral antidiabetic that reduces hepatic glucose production and improves insulin sensitivity. This peptide or oligopeptide is studied for its biologi...

Diabetes Drugs beginner

Methadone Opioid Maintenance: Comprehensive Peptide Refer...

Synthetic opioid for opioid use disorder treatment and pain management. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides beginner

Methionine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Methionine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...

Amino Acid Metabolism intermediate

Methionine Modification: Post-Translational Modification ...

Post-translational modifications of Methionine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...

Amino Acid Modifications intermediate

Methionine Peptide: Oligopeptide Research Reference

Methionine (M) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...

Amino Acid Peptides beginner

Methionine-Enkephalin: Neuropeptide in Neuroscience Refer...

Endogenous opioid with delta-selectivity and roles in pain and reward. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides intermediate

Method: Oligopeptide Research Reference

Method is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...

Biomarkers Expanded intermediate

Methylation (Lys/Arg): Oligopeptide Research Reference

Addition of methyl groups to lysine or arginine. Affects protein interactions. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

Methyltransferase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Methyltransferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide-Drug Conjugates advanced

mg-g: Oligopeptide Research Reference

Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...

Peptide Technologies intermediate

mg: Oligopeptide Research Reference

Low. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research...

Peptide Technologies intermediate

MiAMP1: Oligopeptide Research Reference

MiAMP1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Micafungin: Oligopeptide Research Reference

Echinocandin antifungal for invasive fungal infections including candidemia. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Drugs intermediate

Micelle Assembly System 1: Comprehensive Peptide Reference

A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Micelle Assembly System 2: Comprehensive Peptide Reference

A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Micelle Assembly System 3: Comprehensive Peptide Reference

A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Micelle encapsulation: Oligopeptide Research Reference

Comprehensive reference for micelle encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Micelle System 1: Oligopeptide Research Reference

A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Micelle System 2: Oligopeptide Research Reference

A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Micelle System 3: Oligopeptide Research Reference

A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Microcystis aeruginosa: Oligopeptide Research Reference

Inhibits protein phosphatases PP1 and PP2A. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Protist Peptides intermediate

Microdissection Analysis: Analytical Technique in Peptide...

An analytical technique for characterizing peptides using Microdissection. This analytical technique provides valuable insights into peptide structure, purit...

Analytical Techniques advanced

Microfluidic Peptide Synthesis

Continuous flow SPPS in microreactors. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Peptide Therapeutics intermediate

Microfluidic Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Microfluidic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

Microneedle Delivery: Oligopeptide Research Reference

Using microneedles for transdermal peptide delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...

Peptide Therapeutics intermediate

Microneedle Peptide Delivery: Comprehensive Peptide Refer...

Dissolving microneedle arrays for transdermal peptide delivery bypassing GI degradation. This peptide or oligopeptide is studied for its biological activity,...

Drug Delivery intermediate

Microneedle: Oligopeptide Research Reference

Minutes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical rese...

Peptide Technologies intermediate

MicroRNA: Oligopeptide Research Reference

Comprehensive reference for microrna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

microscopy for Peptides: Analytical Technique in Peptide ...

Application of microscopy technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...

Structural Biology Techniques advanced

Microtubule assembly: Oligopeptide Research Reference

Comprehensive reference for microtubule assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Microtubule destabilizer: Oligopeptide Research Reference

Comprehensive reference for microtubule destabilizer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Microtubule dynamics: Oligopeptide Research Reference

Comprehensive reference for microtubule dynamics, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Microtubule stabilizer: Oligopeptide Research Reference

Comprehensive reference for microtubule stabilizer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Microwave Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Microwave for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Microwave-Assisted SPPS: Oligopeptide Research Reference

mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Microwave-Assisted Synthesis: Comprehensive Peptide Refer...

Comprehensive reference for Microwave-Assisted Synthesis, a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Migraine Peptides: Oligopeptide Research Reference

Peptides associated with Migraine including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...

Disease-Associated Peptides intermediate

Milestone 001: Oligopeptide Research Reference

1921: Discovery of insulin by Banting and Best. First peptide hormone isolated for therapeutic use. Nobel Prize 1923. Covers molecular mechanisms, biological...

Peptide Therapeutics intermediate

Milestone 002: Oligopeptide Research Reference

1951: Frederick Sanger determines amino acid sequence of insulin. Nobel Prize 1958. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Milestone 003: Oligopeptide Research Reference

1953: Vincent du Vigneaud synthesizes oxytocin. First chemical synthesis of a peptide hormone. Nobel Prize 1955. Covers molecular mechanisms, biological acti...

Peptide Therapeutics intermediate

Milestone 004: Oligopeptide Research Reference

1963: Robert Bruce Merrifield develops solid-phase peptide synthesis (SPPS). Revolutionizes peptide chemistry. Nobel Prize 1984.

Peptide Therapeutics intermediate

Milestone 005: Oligopeptide Research Reference

1977: Opioid peptides (enkephalins) discovered by Kosterlitz and Hughes. Endogenous pain modulation. Nobel Prize 2004. Covers molecular mechanisms, biologica...

Peptide Therapeutics intermediate

Milestone 006: Oligopeptide Research Reference

1982: Humulin (recombinant human insulin) approved by FDA. First biotechnology product. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Therapeutics intermediate

Milestone 007: Oligopeptide Research Reference

1987: Zasloff discovers magainins from frog skin. Opens field of antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity,...

Peptide Therapeutics intermediate

Milestone 008: Oligopeptide Research Reference

1993: First GLP-1 agonist (exenatide) discovered from Gila monster venom. Opens incretin therapy. This peptide or oligopeptide is studied for its biological ...

Peptide Therapeutics intermediate

Milestone 009: Oligopeptide Research Reference

1998: First GnRH antagonist (cetrorelix) approved. Advances reproductive medicine. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

Milestone 010: Oligopeptide Research Reference

2001: Click chemistry Nobel Prize (Sharpless, Meldal, Bertozzi). Enables bioorthogonal conjugation. This peptide or oligopeptide is studied for its biologica...

Peptide Therapeutics intermediate

Milestone 011: Oligopeptide Research Reference

2003: First anti-TNF biologic (adalimumab) approved. Opens era of biologic immunotherapy. This peptide or oligopeptide is studied for its biological activity...

Peptide Therapeutics intermediate

Milestone 012: Oligopeptide Research Reference

2011: First GLP-1 agonist for obesity (liraglutide/Saxenda) approved. Revolutionizes obesity treatment. This peptide or oligopeptide is studied for its biolo...

Peptide Therapeutics intermediate

Milestone 013: Oligopeptide Research Reference

2014: First checkpoint inhibitor (ipilimumab) approved for melanoma. Opens era of cancer immunotherapy. This peptide or oligopeptide is studied for its biolo...

Peptide Therapeutics intermediate

Milestone 014: Oligopeptide Research Reference

2017: Semaglutide (Ozempic) approved for type 2 diabetes. Once-weekly GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Therapeutics intermediate

Milestone 015: Oligopeptide Research Reference

2020: AlphaFold2 achieves near-experimental protein structure prediction. CASP14 winner. This peptide or oligopeptide is studied for its biological activity,...

Peptide Therapeutics intermediate

Milestone 016: Oligopeptide Research Reference

2021: Semaglutide (Wegovy) approved for obesity. STEP trials show 15% weight loss. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Therapeutics intermediate

Milestone 017: Oligopeptide Research Reference

2022: Tirzepatide (Mounjaro) approved. Dual GIP/GLP-1 agonist with 22.5% weight loss. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Therapeutics intermediate

Milestone 018: Oligopeptide Research Reference

2023: SELECT trial shows semaglutide reduces cardiovascular events by 20% in obesity. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Therapeutics intermediate

Milestone 019: Oligopeptide Research Reference

2024: Nobel Prize in Chemistry for AlphaFold (Hassabis, Jumper). This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

Milestone 020: Oligopeptide Research Reference

2025: First oral GLP-1 agonist achieves widespread adoption. Transforms diabetes treatment. This peptide or oligopeptide is studied for its biological activi...

Peptide Therapeutics intermediate

Milestone 021: Oligopeptide Research Reference

1922: First clinical use of insulin in human patients. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...

Peptide Therapeutics intermediate

Milestone 022: Oligopeptide Research Reference

1955: Du Vigneaud synthesizes oxytocin and vasopressin. First total synthesis of peptide hormones. This peptide or oligopeptide is studied for its biological...

Peptide Therapeutics intermediate

Milestone 023: Oligopeptide Research Reference

1965: First total synthesis of ribonuclease A by Merrifield. Demonstrates SPPS power. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Therapeutics intermediate

Milestone 024: Oligopeptide Research Reference

1970: Schally and Guillemin isolate TRH, LH-RH, and somatostatin. Nobel Prize 1977. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Milestone 025: Oligopeptide Research Reference

1975: Enkephalins discovered. Endogenous opioid peptides identified. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Therapeutics intermediate

Milestone 026: Oligopeptide Research Reference

1980: First monoclonal antibody (OKT3) approved. Opens era of antibody therapeutics. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Therapeutics intermediate

Milestone 027: Oligopeptide Research Reference

1985: First synthetic peptide drug (desmopressin) gains widespread use. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Milestone 028: Oligopeptide Research Reference

1990: First recombinant monoclonal antibody (abciximab) approved. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Milestone 029: Oligopeptide Research Reference

2000: Human genome sequenced. Enables genomics-driven peptide drug discovery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Therapeutics intermediate

Milestone 030: Oligopeptide Research Reference

2010: First peptide-drug conjugate (brentuximab vedotin) approved. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Milk Casokinin: Oligopeptide Research Reference

milk casokinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Food-Derived Peptides intermediate

Milk Lactokinin: Oligopeptide Research Reference

milk lactokinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Food-Derived Peptides intermediate

Milk Lactorphin: Oligopeptide Research Reference

milk lactorphin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Food-Derived Peptides intermediate

Millet Peptide: Oligopeptide Research Reference

A bioactive peptide derived from millet with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Mimetic System 1: Oligopeptide Research Reference

A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Mimetic System 2: Oligopeptide Research Reference

A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Mimetic System 3: Oligopeptide Research Reference

A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Mineral-Binding Peptides: Oligopeptide Research Reference

Comprehensive reference for Mineral-Binding Peptides, a peptide compound with applications in research and therapeutics.

Food Peptides intermediate

Minibody System 1: Oligopeptide Research Reference

A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Minibody System 2: Oligopeptide Research Reference

A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Minibody System 3: Oligopeptide Research Reference

A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Minibody: Oligopeptide Research Reference

Comprehensive reference for minibody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Minutes: Oligopeptide Research Reference

Non-invasive. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Peptide Technologies intermediate

Miraculin: Oligopeptide Research Reference

miraculin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Agricultural Peptides intermediate

MIT OCW Biochemistry: Oligopeptide Research Reference

MIT OpenCourseWare resource on biochemistry. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

Mixed: Oligopeptide Research Reference

Binding + cleavage or modification + binding. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Interactions intermediate

MMP Inhibitor: Enzyme in Peptide Biology Reference

MMP inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifici...

Enzyme Peptides intermediate

MOD-001: Post-Translational Modification Reference

Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-003: Post-Translational Modification Reference

Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-005: Post-Translational Modification Reference

Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-007: Post-Translational Modification Reference

Side Chain. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...

Peptide Modifications intermediate

MOD-009: Post-Translational Modification Reference

Side Chain. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...

Peptide Modifications intermediate

MOD-011: Post-Translational Modification Reference

Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-013: Post-Translational Modification Reference

Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-015: Post-Translational Modification Reference

Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...

Peptide Modifications intermediate

MOD-017: Post-Translational Modification Reference

Cyclization. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized the...

Peptide Modifications intermediate

MOD-019: Post-Translational Modification Reference

Cyclization. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized the...

Peptide Modifications intermediate

Modeccin: Oligopeptide Research Reference

Modeccin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

ModelArchive: Oligopeptide Research Reference

Database of computational models for biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Modification: Oligopeptide Research Reference

Covalent modification (disulfide, conformational). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Interactions intermediate

Modulates glucose sensing GPCR pathway

Yeast signaling peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

Mojave Toxin: Oligopeptide Research Reference

Mojave Toxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Molding Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Molding for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...

Peptide Synthesis Methods advanced

Molecular Dynamics for Peptides

A computational method for studying peptides using Molecular Dynamics. This analytical technique provides valuable insights into peptide structure, purity, a...

Computational Methods advanced

Molecular Dynamics for Peptides

Explore computational molecular dynamics simulations for predicting peptide conformational behavior and folding. Covers molecular mechanisms, biological acti...

Peptide Analysis advanced

Molecular Dynamics: Oligopeptide Research Reference

High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Molecular Glue System 1: Oligopeptide Research Reference

A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Molecular Glue System 2: Oligopeptide Research Reference

A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Molecular Glue System 3: Oligopeptide Research Reference

A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Molecular glue: Oligopeptide Research Reference

Comprehensive reference for molecular glue, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Molecular Mechanics for Peptides

A computational method for studying peptides using Molecular Mechanics. This analytical technique provides valuable insights into peptide structure, purity, ...

Computational Methods advanced

Molten Globule System 1: Oligopeptide Research Reference

A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Molten Globule System 2: Oligopeptide Research Reference

A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Molten Globule System 3: Oligopeptide Research Reference

A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Momordin I: Oligopeptide Research Reference

momordin-I is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...

Plant Peptides intermediate

Momordin II: Oligopeptide Research Reference

momordin-II is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.

Plant Peptides intermediate

Monellin: Oligopeptide Research Reference

monellin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Agricultural Peptides intermediate

Monte Carlo for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using Monte Carlo. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

morbidity Resource: Oligopeptide Research Reference

The morbidity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Moricin (Bombyx): Oligopeptide Research Reference

Moricin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Moronecidin: Oligopeptide Research Reference

Moronecidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Morphiceptin: Neuropeptide in Neuroscience Reference

morphiceptin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Morphine-3-Glucuronide: Neuropeptide in Neuroscience Refe...

Morphine metabolite with neuroexcitatory effects opposing M6G. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides intermediate

Morphine-6-Glucuronide: Neuropeptide in Neuroscience Refe...

Active metabolite of morphine with potent mu-opioid agonist activity. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

Morpholino oligomer: Oligopeptide Research Reference

Comprehensive reference for morpholino oligomer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Morpholino-peptide conjugate: Comprehensive Peptide Refer...

Comprehensive reference for morpholino-peptide conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

mortality Resource: Oligopeptide Research Reference

The mortality database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Motilin 1-10: Peptide Fragment Reference

Comprehensive reference for motilin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-12: Peptide Fragment Reference

Comprehensive reference for motilin 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-14: Peptide Fragment Reference

Comprehensive reference for motilin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-22: Peptide Fragment Reference

Comprehensive reference for motilin 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-4: Peptide Fragment Reference

Comprehensive reference for motilin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-6: Peptide Fragment Reference

Comprehensive reference for motilin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 1-8: Peptide Fragment Reference

Comprehensive reference for motilin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 13-22: Peptide Fragment Reference

Comprehensive reference for motilin 13-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin 9-22: Peptide Fragment Reference

Comprehensive reference for motilin 9-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin erythromycin-analog: Comprehensive Peptide Reference

Comprehensive reference for motilin erythromycin-analog variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Motilin family / Gut hormone: Comprehensive Peptide Refer...

Motilin family / Gut hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...

Neuropeptides intermediate

Motilin Hormone: Endogenous Peptide Hormone Reference

Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Motilin Peptide Hormone: Endogenous Peptide Hormone Refer...

Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Motilin Protein Hormone: Endogenous Peptide Hormone Refer...

Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Motilin: Endogenous Peptide Hormone Reference

22-amino acid gut hormone that stimulates gastric and intestinal motility through the migrating motor complex. This peptide or oligopeptide is studied for it...

Gastrointestinal Peptides intermediate

Motor protein dynein: Oligopeptide Research Reference

Comprehensive reference for motor protein dynein, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Motor protein kinesin: Oligopeptide Research Reference

Comprehensive reference for motor protein kinesin, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Motor protein myosin: Oligopeptide Research Reference

Comprehensive reference for motor protein myosin, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Mouse Beta-Defensin 3: Antimicrobial Peptide Reference

Inducible mouse beta-defensin with chemotactic and antimicrobial functions. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides intermediate

Mouse Cathelicidin CRAMP: Antimicrobial Peptide Reference

Mouse equivalent of human LL-37 with antimicrobial and immunomodulatory properties. This antimicrobial peptide demonstrates activity against pathogens and is...

Antimicrobial Peptides intermediate

MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSN...

Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

mRNA delivery: Oligopeptide Research Reference

Comprehensive reference for mrna delivery, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

MRNA System 1: Oligopeptide Research Reference

A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

MRNA System 2: Oligopeptide Research Reference

A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

MRNA System 3: Oligopeptide Research Reference

A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

Ms Autoimmune Peptides: Oligopeptide Research Reference

Peptides associated with Ms Autoimmune including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...

Disease-Associated Peptides intermediate

Ms Peptides: Oligopeptide Research Reference

Peptides associated with Ms including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological act...

Disease-Associated Peptides intermediate

MSH alpha-1-10: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH alpha-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH alpha-1-13: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH alpha-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH alpha-1-4: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH alpha-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH alpha-1-5: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH alpha-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH alpha-1-8: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH alpha-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH beta-1-13: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH beta-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH beta-1-18: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH beta-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH beta-1-22: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH beta-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH gamma-1-10: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH gamma-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH gamma-1-13: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH gamma-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH Hormone: Endogenous Peptide Hormone Reference

MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

MSH NDP-MSH: Endogenous Peptide Hormone Reference

Comprehensive reference for MSH NDP-MSH variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

MSH Peptide Hormone: Endogenous Peptide Hormone Reference

MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

MSH Protein Hormone: Endogenous Peptide Hormone Reference

MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

MTOR Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting MTOR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

MTOR Modulator: Oligopeptide Research Reference

mTOR modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Signaling Peptides intermediate

mTOR Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

mTOR Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

mTOR Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

mTOR Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

mTOR Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Mu Conotoxin GIIIA: Peptide Toxin in Pharmacology Reference

mu-conotoxin-GIIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...

Venom Peptides intermediate

Mu Conotoxin GIIIB: Peptide Toxin in Pharmacology Reference

mu-conotoxin-GIIIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...

Venom Peptides intermediate

Mu Conotoxin GIIIC: Peptide Toxin in Pharmacology Reference

mu-conotoxin-GIIIC is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...

Venom Peptides intermediate

Mu-Conotoxin MrVIB: Peptide Toxin in Pharmacology Reference

Sodium channel blocker from Conus magus with local anesthetic potential. This peptide toxin is derived from venom and studied for its pharmacological activit...

Venom Peptides intermediate

Mucoadhesive Peptide Systems: Comprehensive Peptide Refer...

Mucoadhesive formulations adhering to GI mucosa for extended peptide absorption. This peptide or oligopeptide is studied for its biological activity, structu...

Drug Delivery intermediate

Mucus-Penetrating Peptide Delivery

Learn nanoparticle designs that penetrate mucosal barriers for enhanced peptide absorption at mucosal sites. This peptide or oligopeptide is studied for its ...

Drug Delivery advanced

Multi Head Attention for Peptides

A computational method for studying peptides using Multi Head Attention. This analytical technique provides valuable insights into peptide structure, purity,...

Computational Methods advanced

Multi-Target Peptides: Oligopeptide Research Reference

Multi-Target Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Drug Development intermediate

MultiPep: Oligopeptide Research Reference

MultiPep, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Research Tools intermediate

Multiple Myeloma: Oligopeptide Research Reference

Plasma cell malignancy. Monoclonal protein, bone lesions, anemia. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Multiple Sclerosis and Peptides

Explore peptide immunotherapies for multiple sclerosis targeting myelin-specific immune responses. This peptide or oligopeptide is studied for its biological...

Peptide Therapeutics advanced

Multiple Sclerosis: Oligopeptide Research Reference

Chronic autoimmune demyelinating disease of the central nervous system. Relapsing-remitting (85% initially), secondary progressive, primary progressive. Path...

Peptide Therapeutics intermediate

multipole Resource: Oligopeptide Research Reference

The multipole database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Mulundocandin: Oligopeptide Research Reference

Mulundocandin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Murepavadin: Oligopeptide Research Reference

Murepavadin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Muromonab-CD3: Oligopeptide Research Reference

First monoclonal antibody approved for clinical use, targeting CD3 for acute transplant rejection reversal. This peptide or oligopeptide is studied for its b...

Transplant Peptides intermediate

Muscarine: Oligopeptide Research Reference

Muscarine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Muscimol: Oligopeptide Research Reference

Muscimol, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Musculoskeletal / Anabolic Bone Agent

Musculoskeletal / Anabolic Bone Agent is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...

Peptide Analogs intermediate

Mussel Antimicrobial Peptides: Comprehensive Peptide Refe...

AMPs from blue mussel hemolymph defending against marine pathogens. This antimicrobial peptide demonstrates activity against pathogens and is studied for its...

Antimicrobial Peptides intermediate

Myasthenia Graves Peptides: Comprehensive Peptide Reference

Peptides associated with Myasthenia Graves including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...

Disease-Associated Peptides intermediate

Myeloma Peptides: Oligopeptide Research Reference

Peptides associated with Myeloma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Myocardial Infarction: Oligopeptide Research Reference

Acute myocardial necrosis from prolonged ischemia. STEMI: complete coronary occlusion, ST elevation on ECG, troponin elevation. NSTEMI: partial occlusion, no...

Peptide Therapeutics intermediate

Myoglobin: Oligopeptide Research Reference

17.8 kDa heme-containing oxygen-binding protein released from damaged muscle. Normal: <85 ng/mL (male), <75 ng/mL (female). Earliest biomarker of MI (rises 1...

Peptide Therapeutics intermediate

Myriocin iridium: Oligopeptide Research Reference

Inhibits serine palmitoyltransferase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Yeast Peptides intermediate

Myrmicacin (Myrmica): Oligopeptide Research Reference

Myrmicacin (Myrmica), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Myticus: Structure, Function, and Significance

Myticus peptides are antimicrobial peptides from mussel hemolymph with antifungal and antibacterial properties. Covers molecular mechanisms, biological activ...

Antimicrobial Peptides intermediate

Myxinidin: Oligopeptide Research Reference

Myxinidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

N Gonorrhoeae Peptide: Oligopeptide Research Reference

A peptide associated with N Gonorrhoeae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

N Meningitidis Peptide: Oligopeptide Research Reference

A peptide associated with N Meningitidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struc...

Microbial Peptides intermediate

N Terminal Mod System 1: Oligopeptide Research Reference

A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

N Terminal Mod System 2: Oligopeptide Research Reference

A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

N Terminal Mod System 3: Oligopeptide Research Reference

A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

N-Acylation: Oligopeptide Research Reference

Addition of acyl groups to N-terminus. Modifies pharmacokinetic properties. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Therapeutics intermediate

N-Glycosylation of Peptides: Comprehensive Peptide Reference

Comprehensive guide to N-glycosylation modifications on asparagine residues in peptide biology. This modification affects peptide stability, receptor binding...

Peptide Modifications advanced

N-Methylation: Oligopeptide Research Reference

Addition of methyl group to backbone nitrogen. Increases proteolytic resistance. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

N-Terminal Acetylation: Oligopeptide Research Reference

Addition of acetyl group to N-terminus. Protects against aminopeptidase degradation. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Therapeutics intermediate

N-Terminal PEGylation: Post-Translational Modification Re...

N-Terminal PEGylation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Modifications intermediate

N-Terminal Pyroglutamate: Oligopeptide Research Reference

Cyclization of N-terminal glutamine to pyroglutamic acid. Protects against degradation. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Therapeutics intermediate

Na+ channel blocker with N-hydroxylation

Dinoflagellate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Protist Peptides intermediate

NAC Dipeptide: Oligopeptide Research Reference

NAC dipeptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Antioxidant Peptides intermediate

Nafarelin: Oligopeptide Research Reference

nafarelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

Nafarelin: Oligopeptide Research Reference

Nasal GnRH agonist for endometriosis pain and central precocious puberty. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Peptide Drugs intermediate

Nafithromycin: Oligopeptide Research Reference

Nafithromycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Nalmefene Alcohol Antagonist: Comprehensive Peptide Refer...

Long-acting opioid antagonist for alcohol use disorder. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...

Neuropeptides beginner

Naloxone Opioid Antagonist: Comprehensive Peptide Reference

Competitive opioid antagonist for emergency overdose reversal. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides beginner

Naltrexone Maintenance: Neuropeptide in Neuroscience Refe...

Long-acting oral opioid antagonist for addiction and alcohol treatment. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides beginner

Nanobody Conjugation Synthesis

A peptide synthesis method using Nanobody Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Nanobody System 1: Oligopeptide Research Reference

A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Nanobody System 2: Oligopeptide Research Reference

A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Nanobody System 3: Oligopeptide Research Reference

A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Nanobody: Oligopeptide Research Reference

Comprehensive reference for nanobody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Nanocrystalline Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Nanocrystalline for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Nanoemulsion Peptide Delivery: Comprehensive Peptide Refe...

Nanoemulsion systems for improving peptide oral bioavailability. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Drug Delivery intermediate

Nanoparticle Delivery: Oligopeptide Research Reference

Encapsulating peptides in nanoparticles for targeted delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Nanoparticle encapsulation: Comprehensive Peptide Reference

Comprehensive reference for nanoparticle encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Nanoparticle Formulation: Oligopeptide Research Reference

Comprehensive reference for Nanoparticle Formulation, a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Nanoparticle Oral Peptide: Comprehensive Peptide Reference

Polymeric nanoparticles protecting and delivering peptides through intestinal barrier. This peptide or oligopeptide is studied for its biological activity, s...

Drug Delivery intermediate

Nanoparticle Peptide Delivery: Comprehensive Peptide Refe...

Understand nanoparticle encapsulation strategies for protecting and delivering peptide drugs to target tissues. Covers molecular mechanisms, biological activ...

Drug Delivery advanced

Nanoparticle Self Assembly System 1

A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

Nanoparticle Self Assembly System 2

A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

Nanoparticle Self Assembly System 3

A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.

Drug Delivery Systems advanced

Nanoparticle System 1: Oligopeptide Research Reference

A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Nanoparticle System 2: Oligopeptide Research Reference

A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Nanoparticle System 3: Oligopeptide Research Reference

A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...

Drug Delivery Systems advanced

Nanoparticle: Oligopeptide Research Reference

Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...

Peptide Technologies intermediate

Nanotechnology: Oligopeptide Research Reference

Peptide-based nanotechnology applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Peptide Therapeutics intermediate

Narcolepsy Peptides: Oligopeptide Research Reference

Peptides associated with Narcolepsy including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Nasal delivery system: Oligopeptide Research Reference

Comprehensive reference for nasal delivery system, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Nasal Delivery: Oligopeptide Research Reference

Delivering peptides through nasal mucosa for brain targeting. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...

Peptide Therapeutics intermediate

Nasal Peptide Delivery: Oligopeptide Research Reference

Explore intranasal peptide delivery routes for bypassing first-pass metabolism and achieving brain targeting. This peptide or oligopeptide is studied for its...

Drug Delivery intermediate

Nasal System 1: Oligopeptide Research Reference

A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Nasal System 2: Oligopeptide Research Reference

A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Nasal System 3: Oligopeptide Research Reference

A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Nasal: Oligopeptide Research Reference

Minutes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical rese...

Peptide Technologies intermediate

Natamycin: Oligopeptide Research Reference

Natamycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Native Chemical Ligation (NCL)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Native Chemical Ligation Synthesis

A peptide synthesis method using Native Chemical Ligation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...

Peptide Synthesis Methods advanced

Native Chemical Ligation: Oligopeptide Research Reference

Cys + thioester → native peptide bond. Enables protein synthesis up to ~200 aa. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

Native PAGE Analysis: Analytical Technique in Peptide Res...

An analytical technique for characterizing peptides using Native PAGE. This analytical technique provides valuable insights into peptide structure, purity, a...

Analytical Techniques advanced

Natriuretic Peptide Family: Comprehensive Peptide Reference

Explore ANP, BNP, and CNP natriuretic peptides in cardiovascular and renal homeostasis. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Families intermediate

NCBI GenBank: Oligopeptide Research Reference

Genetic sequence database maintained by NCBI. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

NCBI Gene: Oligopeptide Research Reference

Gene database with information about gene structure, function, and expression. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Therapeutics intermediate

NCLNGGYCPGQ: Oligopeptide Research Reference

Tetrahymena thermophila. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Protist Peptides intermediate

NDFVNKLNKLIEN: Oligopeptide Research Reference

Plasmodium falciparum. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Protist Peptides intermediate

NEM Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using NEM. This analytical technique provides valuable insights into peptide structure, purity...

Purification Methods advanced

Nematicidal Peptides: Oligopeptide Research Reference

Nematicidal Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Nematode Antifungal / Nematicidal

Nematode Antifungal / Nematicidal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Worm Peptides intermediate

Nematode Defense Peptides: Comprehensive Peptide Reference

Comprehensive reference for Nematode Defense Peptides, a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Nematode Excretory Peptides: Comprehensive Peptide Reference

Comprehensive reference for Nematode Excretory Peptides, a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Nematode Insulin-like Peptide: Comprehensive Peptide Refe...

Nematode Insulin-like Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Worm Peptides intermediate

Nematode Neuropeptide / FMRFamide

Nematode Neuropeptide / FMRFamide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Worm Peptides intermediate

Nematode Neuropeptide / NLP: Comprehensive Peptide Reference

Nematode Neuropeptide / NLP is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...

Worm Peptides intermediate

Nematode Parasitic / Secreted: Comprehensive Peptide Refe...

Nematode Parasitic / Secreted is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...

Worm Peptides intermediate

Nematode Parasitic / Surface: Comprehensive Peptide Refer...

Nematode Parasitic / Surface is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...

Worm Peptides intermediate

Nematode Secreted Peptides: Comprehensive Peptide Reference

Comprehensive reference for Nematode Secreted Peptides, a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Nematode Surface Peptides: Comprehensive Peptide Reference

Comprehensive reference for Nematode Surface Peptides, a peptide compound with applications in research and therapeutics.

Worm Peptides intermediate

Neoendorphin Alpha: Neuropeptide in Neuroscience Reference

neoendorphin-alpha is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Neoendorphin Beta: Neuropeptide in Neuroscience Reference

neoendorphin-beta is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Neonatal AMPs: Antimicrobial Peptide Reference

Immature defensin expression in neonates contributing to infection susceptibility. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides intermediate

Neosaxitoxin: Oligopeptide Research Reference

Neosaxitoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Nephrotoxicity: Oligopeptide Research Reference

Kidney damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Peptide Therapeutics intermediate

Neprilysin Inhibitor: Enzyme in Peptide Biology Reference

neprilysin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate sp...

Enzyme Peptides intermediate

Nerve Growth Factor 1-118: Comprehensive Peptide Reference

Comprehensive reference for nerve growth factor 1-118, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor 1-30: Oligopeptide Research Reference

Comprehensive reference for nerve growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor 1-50: Oligopeptide Research Reference

Comprehensive reference for nerve growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor 1-70: Oligopeptide Research Reference

Comprehensive reference for nerve growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor 1-90: Oligopeptide Research Reference

Comprehensive reference for nerve growth factor 1-90, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor fragment-1-10

Comprehensive reference for nerve growth factor fragment-1-10, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor fragment-20-50

Comprehensive reference for nerve growth factor fragment-20-50, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nerve Growth Factor fragment-50-118

Comprehensive reference for nerve growth factor fragment-50-118, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Nesiritide: Oligopeptide Research Reference

nesiritide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Nesiritide: Oligopeptide Research Reference

Recombinant B-type natriuretic peptide for acute decompensated heart failure, promoting vasodilation and natriuresis. Covers molecular mechanisms, biological...

Cardiovascular Peptides intermediate

Nesiritide: Oligopeptide Research Reference

Recombinant BNP for acute decompensated heart failure reducing cardiac filling pressures. This peptide or oligopeptide is studied for its biological activity...

Peptide Drugs intermediate

Nestin intermediate filament: Comprehensive Peptide Refer...

Comprehensive reference for nestin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Netrin 1 Mimetic: Oligopeptide Research Reference

netrin 1 mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Neurological Peptides intermediate

Neuregulin Hormone: Endogenous Peptide Hormone Reference

Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Neuregulin Peptide Hormone: Comprehensive Peptide Reference

Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Neuregulin Protein Hormone: Comprehensive Peptide Reference

Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Neurodegeneration / Protein Misfolding

Neurodegeneration / Protein Misfolding is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologica...

Peptide Interactions intermediate

Neuroendocrine Tumors: Oligopeptide Research Reference

Neuroendocrine Tumors, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Oncology intermediate

Neurofilament Light Chain (NfL)

Comprehensive reference for Neurofilament Light Chain (NfL), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Neurohypophysial peptide: Neuropeptide in Neuroscience Re...

Neurohypophysial peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Neuropeptides intermediate

Neurokinin A: Neuropeptide in Neuroscience Reference

Neurokinin A is a tachykinin peptide that activates NK2 receptors to regulate airway function, gastrointestinal motility, and inflammatory responses.

Neuropeptides intermediate

Neurokinin B: Neuropeptide in Neuroscience Reference

neurokinin-B is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biolog...

Neuropeptides intermediate

Neurological Disorders: Oligopeptide Research Reference

Diseases of the nervous system: neurodegenerative (Alzheimer's, Parkinson's, ALS), autoimmune (MS), vascular (stroke), epileptic, psychiatric (depression, sc...

Peptide Therapeutics intermediate

Neurological: Oligopeptide Research Reference

AD diagnosis, neurodegeneration, prion disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Biomarkers Expanded intermediate

Neurology / Neuromuscular Blocker

Neurology / Neuromuscular Blocker is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Therapeutic Peptides Expanded intermediate

Neurology/Pain: Oligopeptide Research Reference

Clinical trials for neurological and pain conditions. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...

Peptide Therapeutics intermediate

Neuromedin B: Neuropeptide in Neuroscience Reference

Bombesin-related neuropeptide with roles in satiety and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles...

Neuropeptides intermediate

Neuromedin U: Neuropeptide in Neuroscience Reference

Neuropeptide expressed in gut and brain regulating energy homeostasis. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides intermediate

Neuropathic Pain Peptides: Comprehensive Peptide Reference

Peptides associated with Neuropathic Pain including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its ...

Disease-Associated Peptides intermediate

Neuropeptide B (NPB): Neuropeptide in Neuroscience Reference

Neuropeptide B (NPB), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Neuropeptide B: Neuropeptide in Neuroscience Reference

Hypothalamic neuropeptide involved in feeding regulation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain funct...

Neuropeptides intermediate

Neuropeptide B/W family: Neuropeptide in Neuroscience Ref...

ID. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

Neuropeptide FF: Neuropeptide in Neuroscience Reference

Octapeptide with opioid-modulating and cardiovascular effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides intermediate

Neuropeptide Gamma: Neuropeptide in Neuroscience Reference

neuropeptide-gamma is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its ...

Neuropeptides intermediate

Neuropeptide K: Neuropeptide in Neuroscience Reference

neuropeptide-K is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biol...

Neuropeptides intermediate

Neuropeptide S (NPS): Neuropeptide in Neuroscience Reference

Neuropeptide S (NPS), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Neuropeptide S: Neuropeptide in Neuroscience Reference

A 20-amino acid neuropeptide that promotes wakefulness and anxiolysis through NPSR1 receptor activation, with genetic variants linked to asthma and anxiety.

Neuropeptides intermediate

Neuropeptide Structure: Oligopeptide Research Reference

Neuropeptide Structure is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Peptide Interactions intermediate

Neuropeptide W (NPW): Neuropeptide in Neuroscience Reference

Neuropeptide W (NPW), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Neuropeptide W: Neuropeptide in Neuroscience Reference

Hypothalamic neuropeptide regulating energy homeostasis and feeding. This neuropeptide is involved in neurological signaling and is studied for its roles in ...

Neuropeptides intermediate

Neuropeptide Y (NPY): Neuropeptide in Neuroscience Reference

Neuropeptide Y (NPY), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Neuropeptide Y family / Gut hormone

Neuropeptide Y family / Gut hormone is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Neuropeptides intermediate

Neuropeptide Y Family Peptides

Explore NPY, PYY, and pancreatic polypeptide in appetite regulation and energy homeostasis. This peptide or oligopeptide is studied for its biological activi...

Peptide Families intermediate

Neuropeptide Y: Neuropeptide in Neuroscience Reference

A 36-amino acid neuropeptide and the most potent known appetite stimulant, playing central roles in energy homeostasis, stress response, and circadian rhythms.

Neuropeptides intermediate

Neuropilin 1 Antagonist: Oligopeptide Research Reference

neuropilin 1 antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Neurological Peptides intermediate

Neurotensin: Neuropeptide in Neuroscience Reference

Neurotensin is a 13-amino acid neuropeptide that modulates dopaminergic signaling, regulates thermoregulation, and functions as both a neurotransmitter and g...

Neuropeptides intermediate

Neurotoxicity: Oligopeptide Research Reference

Nervous system damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

NeuroVax: Oligopeptide Research Reference

NeuroVax, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Neurturin Hormone: Endogenous Peptide Hormone Reference

Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Neurturin Peptide Hormone: Comprehensive Peptide Reference

Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Neurturin Protein Hormone: Comprehensive Peptide Reference

Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Neutralizing Antibodies: Oligopeptide Research Reference

Antibodies that neutralize the pharmacological activity of therapeutic peptides. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Neutravidin Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Neutravidin. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

NeuVax (Nelipepimut-S): Oligopeptide Research Reference

NeuVax (Nelipepimut-S), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

neXtProt: Oligopeptide Research Reference

Protein knowledge database with expert annotation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Therapeutics intermediate

NF KB Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting NF KB Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

NF KB Modulator: Oligopeptide Research Reference

NF kB modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Signaling Peptides intermediate

NF-kB Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

NF-kB Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

NF-kB Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

NF-kB Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

NF-kB Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

NGAL Peptide: Oligopeptide Research Reference

NGAL peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Diagnostic Peptides intermediate

NGF Hormone: Endogenous Peptide Hormone Reference

NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NGF Mimetic: Oligopeptide Research Reference

NGF mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Neurological Peptides intermediate

NGF Peptide Hormone: Endogenous Peptide Hormone Reference

NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NGF Protein Hormone: Endogenous Peptide Hormone Reference

NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NGLFNGLNNLNN: Oligopeptide Research Reference

Coleps hirtus. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

Nigrocin: Antimicrobial Peptide Reference

AMP from frog skin with multiple tryptophan residues for membrane insertion. This antimicrobial peptide demonstrates activity against pathogens and is studie...

Antimicrobial Peptides intermediate

Nipah F Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Nipah F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Vaccines advanced

Nisi: Structure, Function, and Significance

Nisin-like peptides from Asian frog skin exhibit broad-spectrum antimicrobial activity with minimal hemolytic activity. Covers molecular mechanisms, biologic...

Antimicrobial Peptides intermediate

Nisin A: Antimicrobial Peptide Reference

nisin-a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against ...

Antimicrobial Peptides intermediate

Nisin Z: Antimicrobial Peptide Reference

nisin-z is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against ...

Antimicrobial Peptides intermediate

Nisin: Antimicrobial Peptide Reference

Lantibiotic peptide from Lactococcus lactis used as a food preservative, with unique lipid II targeting mechanism. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

Nisin: Antimicrobial Peptide Reference

Nisin is a lantibiotic peptide produced by Lactococcus lactis, used as a food preservative since 1969, that kills gram-positive bacteria by binding lipid II ...

Antimicrobial Peptides intermediate

Nitric oxide signaling, PDE enzyme family

Nitric oxide signaling, PDE enzyme family is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Nivolumab: Oligopeptide Research Reference

nivolumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

NK-Lysin Antimicrobial Domain: Comprehensive Peptide Refe...

Antimicrobial domain of porcine NK-lysin with membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides advanced

NKLNDLNRNLND: Oligopeptide Research Reference

Leishmania major. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

NLP-1 (C. elegans): Oligopeptide Research Reference

NLP-1 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-2 (C. elegans): Oligopeptide Research Reference

NLP-2 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-3 (C. elegans): Oligopeptide Research Reference

NLP-3 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-4 (C. elegans): Oligopeptide Research Reference

NLP-4 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-5 (C. elegans): Oligopeptide Research Reference

NLP-5 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-6 (C. elegans): Oligopeptide Research Reference

NLP-6 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-7 (C. elegans): Oligopeptide Research Reference

NLP-7 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-8 (C. elegans): Oligopeptide Research Reference

NLP-8 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLP-9 (C. elegans): Oligopeptide Research Reference

NLP-9 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

NLSNINNNLSTLLE: Oligopeptide Research Reference

Plasmodium falciparum. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Protist Peptides intermediate

NMF for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using NMF. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...

Computational Methods advanced

NMR 1D Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR 1D. This analytical technique provides valuable insights into peptide structure, purity, and ch...

Analytical Techniques advanced

NMR 2D Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR 2D. This analytical technique provides valuable insights into peptide structure, purity, and ch...

Analytical Techniques advanced

NMR CBCACONH Analysis: Analytical Technique in Peptide Re...

An analytical technique for characterizing peptides using NMR CBCACONH. This analytical technique provides valuable insights into peptide structure, purity, ...

Analytical Techniques advanced

NMR COSY Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR COSY. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

NMR for Peptides: Analytical Technique in Peptide Research

Application of NMR technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...

Structural Biology Techniques advanced

NMR HACACB Analysis: Analytical Technique in Peptide Rese...

An analytical technique for characterizing peptides using NMR HACACB. This analytical technique provides valuable insights into peptide structure, purity, an...

Analytical Techniques advanced

NMR HNCA Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR HNCA. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

NMR HNCO Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR HNCO. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

NMR HSQC Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR HSQC. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

NMR NOESY Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using NMR NOESY. This analytical technique provides valuable insights into peptide structure, purity, and...

Analytical Techniques advanced

NMR Spectroscopy for Peptides: Comprehensive Peptide Refe...

Explore NMR spectroscopy techniques for determining peptide three-dimensional structure and dynamics in solution. Covers molecular mechanisms, biological act...

Peptide Analysis advanced

NMR Spectroscopy: Analytical Technique in Peptide Research

>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...

Peptide Analysis intermediate

Nociceptin 1-13: Peptide Fragment Reference

Minimal active fragment of nociceptin for ORL1 receptor activation. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Nociceptin ORL1 Receptor: Receptor Pharmacology Reference

ORL1 receptor activated by nociceptin in pain, anxiety, and reward. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides advanced

Nociceptin: Neuropeptide in Neuroscience Reference

Endogenous ORL1 receptor agonist structurally related to dynorphin. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Nociceptin/Orphanin FQ: Neuropeptide in Neuroscience Refe...

Nociceptin/Orphanin FQ, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Nocistatin: Neuropeptide in Neuroscience Reference

Prodynorphin-derived peptide modulating nociceptin effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fun...

Neuropeptides intermediate

Nodularia spumigena: Oligopeptide Research Reference

Inhibits PP1 and PP2A, smaller cyclic structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Protist Peptides intermediate

Normal Mode for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using Normal Mode. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

Normal Phase Analysis: Analytical Technique in Peptide Re...

An analytical technique for characterizing peptides using Normal Phase. This analytical technique provides valuable insights into peptide structure, purity, ...

Analytical Techniques advanced

Notch Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Notch Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

Notch Modulator: Oligopeptide Research Reference

Notch modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Signaling Peptides intermediate

Notch Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Notch Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Notch Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Notch Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Notch Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Notexin: Peptide Toxin in Pharmacology Reference

Notexin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Novo Nordisk: Oligopeptide Research Reference

Semaglutide, Liraglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Patents intermediate

Noxiustoxin: Peptide Toxin in Pharmacology Reference

Noxiustoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

NP-002: Neuropeptide in Neuroscience Reference

5. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...

Neuropeptides intermediate

NP-004: Neuropeptide in Neuroscience Reference

17. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-006: Neuropeptide in Neuroscience Reference

17. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-008: Neuropeptide in Neuroscience Reference

37. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-010: Neuropeptide in Neuroscience Reference

34. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-012: Neuropeptide in Neuroscience Reference

28. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-014: Neuropeptide in Neuroscience Reference

28. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-016: Neuropeptide in Neuroscience Reference

8. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...

Neuropeptides intermediate

NP-018: Neuropeptide in Neuroscience Reference

22. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-020: Neuropeptide in Neuroscience Reference

14. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-022: Neuropeptide in Neuroscience Reference

10. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-024: Neuropeptide in Neuroscience Reference

39. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-026: Neuropeptide in Neuroscience Reference

9. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...

Neuropeptides intermediate

NP-028: Neuropeptide in Neuroscience Reference

20. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NP-030: Neuropeptide in Neuroscience Reference

23. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...

Neuropeptides intermediate

NPH Insulin (Isophane): Peptide Family Reference

Intermediate-acting insulin preparation using protamine to create crystalline complexes providing 12-18 hour basal coverage.

Insulin Family beginner

NPH Insulin: Oligopeptide Research Reference

Intermediate-acting isophane insulin with protamine suspension providing peak action at 4-10 hours. This peptide or oligopeptide is studied for its biologica...

Peptide Drugs beginner

NPV Resource: Oligopeptide Research Reference

The NPV database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

NPY → Y1R: Oligopeptide Research Reference

NPY → Y1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

NPY Anxiolysis: Neuropeptide in Neuroscience Reference

Anxiolytic effects of NPY through Y1 receptor activation in amygdala. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

NPY Central Effects: Neuropeptide in Neuroscience Reference

Central NPY effects on feeding, energy balance, and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles in ...

Neuropeptides intermediate

NPY Hormone: Endogenous Peptide Hormone Reference

NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NPY Peptide Hormone: Endogenous Peptide Hormone Reference

NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NPY Protein Hormone: Endogenous Peptide Hormone Reference

NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

NRAS Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting NRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

NT 3 Analog: Oligopeptide Research Reference

NT 3 analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Neurological Peptides intermediate

NT 3 Hormone: Endogenous Peptide Hormone Reference

NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT 3 Peptide Hormone: Endogenous Peptide Hormone Reference

NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT 3 Protein Hormone: Endogenous Peptide Hormone Reference

NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT 4 Hormone: Endogenous Peptide Hormone Reference

NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT 4 Peptide Hormone: Endogenous Peptide Hormone Reference

NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT 4 Protein Hormone: Endogenous Peptide Hormone Reference

NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

NT-proBNP (N-Terminal Pro-BNP)

Comprehensive reference for NT-proBNP (N-Terminal Pro-BNP), a peptide compound with applications in research and therapeutics.

Biomarker Peptides intermediate

NT-proBNP: Oligopeptide Research Reference

76-amino acid N-terminal fragment of proBNP. Biologically inactive but cleared by kidneys (t½ ~120 min). More stable than BNP. Normal: <125 pg/mL (<750 pg/mL...

Peptide Therapeutics intermediate

NTRK Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting NTRK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

Nuclear receptor: Oligopeptide Research Reference

Comprehensive reference for nuclear receptor, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Nuclease Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Nuclease Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide-Drug Conjugates advanced

Nuclease PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Nuclease for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide-Drug Conjugates advanced

Nusinersen: Oligopeptide Research Reference

Nusinersen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

NVX-CoV2373: Oligopeptide Research Reference

NVX-CoV2373, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Nystatin (Fungicidin): Oligopeptide Research Reference

Nystatin (Fungicidin), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

O-Glycosylation of Peptides: Comprehensive Peptide Reference

Explore O-glycosylation on serine and threonine residues and its impact on peptide function. This modification affects peptide stability, receptor binding, a...

Peptide Modifications advanced

OaBac11: Oligopeptide Research Reference

OaBac11, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

OaBac5: Oligopeptide Research Reference

OaBac5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

OaDodecapeptide: Oligopeptide Research Reference

OaDodecapeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Oats Peptide: Oligopeptide Research Reference

A bioactive peptide derived from oats with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Obesity and Peptides: Oligopeptide Research Reference

Explore peptide therapeutics targeting obesity including GLP-1/GIP dual agonists and appetite-regulating peptides. Covers molecular mechanisms, biological ac...

Peptide Therapeutics intermediate

Obesity Peptides: Oligopeptide Research Reference

Peptides associated with Obesity including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Obesity Treatment: Oligopeptide Research Reference

Peptide therapeutics for obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Therapeutics intermediate

Obesity: Oligopeptide Research Reference

Excess body fat (BMI ≥30). Multifactorial. Treatments: lifestyle, GLP-1 agonists (semaglutide, tirzepatide), bariatric surgery.

Peptide Therapeutics intermediate

Obestatin Hormone: Endogenous Peptide Hormone Reference

Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Obestatin Peptide Hormone: Comprehensive Peptide Reference

Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Obestatin Protein Hormone: Comprehensive Peptide Reference

Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Obestatin: Endogenous Peptide Hormone Reference

23-amino acid gastric peptide derived from the ghrelin precursor, initially proposed as an anorexigenic hormone. Covers molecular mechanisms, biological acti...

Gastrointestinal Peptides advanced

objective-response Resource: Comprehensive Peptide Reference

The objective-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Octreotide - Acromegaly (NCT00000124)

Trial of octreotide for acromegaly treatment. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

Octreotide LAR: Oligopeptide Research Reference

Long-acting repeatable microsphere formulation of octreotide providing 28-day sustained somatostatin receptor agonism. Covers molecular mechanisms, biologica...

Therapeutic Peptides intermediate

Octreotide: Oligopeptide Research Reference

octreotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Octreotide: Oligopeptide Research Reference

Long-acting somatostatin analog with D-Phe and Thr-ol for acromegaly and carcinoid tumors. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

octupole-moment Resource: Oligopeptide Research Reference

The octupole-moment database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...

Databases & Resources intermediate

Ocular Peptide Delivery: Oligopeptide Research Reference

Ophthalmic delivery systems for peptide drugs targeting anterior and posterior segment. This peptide or oligopeptide is studied for its biological activity, ...

Drug Delivery intermediate

Okadaic Acid: Oligopeptide Research Reference

Okadaic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Oliceridine Biased Agonist: Comprehensive Peptide Reference

G protein-biased mu-opioid agonist with potentially reduced side effects. This neuropeptide is involved in neurological signaling and is studied for its role...

Neuropeptides advanced

Olipudase Alfa: Oligopeptide Research Reference

Olipudase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Omadacycline: Oligopeptide Research Reference

Omadacycline, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Omega Conotoxin SO3: Peptide Toxin in Pharmacology Reference

omega-conotoxin-SO3 is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolo...

Venom Peptides intermediate

Omega-Conotoxin CVID: Peptide Toxin in Pharmacology Refer...

N-type calcium channel blocker from Conus catus with clinical development for pain. This peptide toxin is derived from venom and studied for its pharmacologi...

Venom Peptides intermediate

Omega-Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...

N-type calcium channel blocker from Conus geographus with high selectivity. This peptide toxin is derived from venom and studied for its pharmacological acti...

Venom Peptides intermediate

Omega-Conotoxin MVIIA: Peptide Toxin in Pharmacology Refe...

N-type calcium channel blocker from Conus magus for severe chronic pain. This peptide toxin is derived from venom and studied for its pharmacological activit...

Venom Peptides intermediate

Omega-Conotoxin: Peptide Toxin in Pharmacology Reference

Omega-conotoxins are disulfide-rich peptides from cone snail venom that block N-type and P/Q-type voltage-gated calcium channels, with ziconotide as the appr...

Toxin Peptides advanced

OmegaFold for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using OmegaFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

Omentin Hormone: Endogenous Peptide Hormone Reference

Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Omentin Peptide Hormone: Endogenous Peptide Hormone Refer...

Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Omentin Protein Hormone: Endogenous Peptide Hormone Refer...

Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...

Peptide Hormones intermediate

Omiganan: Antimicrobial Peptide Reference

Synthetic indolicidin-derived antimicrobial peptide under investigation for catheter-related infections and acne vulgaris.

Antimicrobial Peptides intermediate

Oncology / GnRH Agonist: Oligopeptide Research Reference

Oncology / GnRH Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...

Therapeutic Peptides Expanded intermediate

Oncology / GnRH Antagonist (oral)

Oncology / GnRH Antagonist (oral) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Therapeutic Peptides Expanded intermediate

Oncology / Oral GnRH Antagonist

Oncology / Oral GnRH Antagonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Peptide Analogs intermediate

Oncology / Proteasome Inhibitor

Oncology / Proteasome Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...

Therapeutic Peptides intermediate

Oncology: Oligopeptide Research Reference

Clinical trials for cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Peptide Therapeutics intermediate

Oncology/Endocrine / GnRH Agonist

Oncology/Endocrine / GnRH Agonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...

Peptide Analogs intermediate

Onion Peptide: Oligopeptide Research Reference

A bioactive peptide derived from onion with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

OpenFold for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using OpenFold. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

Ophidine: Oligopeptide Research Reference

ophidine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Opioid Cardiovascular Effects: Comprehensive Peptide Refe...

Effects of endogenous opioids on heart rate and blood pressure. This neuropeptide is involved in neurological signaling and is studied for its roles in brain...

Neuropeptides advanced

Opioid Distribution Brain: Comprehensive Peptide Reference

Regional distribution of opioid peptides in brain and pain/reward roles. This neuropeptide is involved in neurological signaling and is studied for its roles...

Neuropeptides advanced

Opioid Distribution Spinal: Comprehensive Peptide Reference

Distribution in dorsal horn and segmental pain modulation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...

Neuropeptides advanced

Opioid Enteric Nervous System: Comprehensive Peptide Refe...

Opioid peptides in enteric and peripheral sensory neurons. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...

Neuropeptides advanced

Opioid Feeding Regulation: Comprehensive Peptide Reference

Endogenous opioid regulation of feeding behavior and food reward. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...

Neuropeptides intermediate

Opioid Immune Effects: Neuropeptide in Neuroscience Refer...

Immunomodulatory effects of endogenous opioids on immune function. This neuropeptide is involved in neurological signaling and is studied for its roles in br...

Neuropeptides advanced

Opioid Neuroendocrine: Neuropeptide in Neuroscience Refer...

Effects on hypothalamic-pituitary axes including cortisol and GH. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...

Neuropeptides advanced

Opioid Peptide Biosensors: Comprehensive Peptide Reference

Genetically encoded biosensors for real-time imaging of opioid peptide signaling. This neuropeptide is involved in neurological signaling and is studied for ...

Neuropeptides advanced

Opioid Peptide Chemogenetics: Comprehensive Peptide Refer...

DREADD-based chemogenetic control of opioid peptide neurons. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fu...

Neuropeptides advanced

Opioid Peptide Computational Modeling

Computational models of opioid peptide-receptor interactions. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...

Neuropeptides advanced

Opioid Peptide Drug Design: Comprehensive Peptide Reference

Structure-based design of novel opioid peptides with improved properties. This neuropeptide is involved in neurological signaling and is studied for its role...

Neuropeptides advanced

Opioid Peptide Family: Oligopeptide Research Reference

Overview of endorphins, enkephalins, and dynorphins in pain modulation and reward pathways. This peptide or oligopeptide is studied for its biological activi...

Peptide Families intermediate

Opioid Peptide Mass Spectrometry

Mass spectrometric methods for identification and quantification of endogenous opioids. This neuropeptide is involved in neurological signaling and is studie...

Neuropeptides advanced

Opioid Peptide Microdialysis: Comprehensive Peptide Refer...

In vivo microdialysis for measuring opioid peptide release in brain regions. This neuropeptide is involved in neurological signaling and is studied for its r...

Neuropeptides advanced

Opioid Peptide Optogenetics: Comprehensive Peptide Reference

Optogenetic control of opioid peptide release from specific neuronal populations. This neuropeptide is involved in neurological signaling and is studied for ...

Neuropeptides advanced

Opioid Peptide Overdose: Oligopeptide Research Reference

Excessive opioid peptide dosing. Can cause respiratory depression. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Opioid Peptide Radioligands: Comprehensive Peptide Reference

Radiolabeled opioid peptides for receptor imaging and binding studies. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides advanced

Opioid Precursor Processing: Comprehensive Peptide Reference

Enzymatic processing of POMC, proenkephalin, and prodynorphin. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides advanced

Opioid Receptor Dimerization: Comprehensive Peptide Refer...

Mu-delta and mu-kappa receptor heterodimer formation affecting selectivity. This neuropeptide is involved in neurological signaling and is studied for its ro...

Neuropeptides advanced

Opioid Receptor Knockout Studies

Behavioral phenotypes from opioid receptor gene knockout mice. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...

Neuropeptides advanced

Opioid Receptor Polymorphisms: Comprehensive Peptide Refe...

Genetic variation affecting analgesic response and addiction susceptibility. This neuropeptide is involved in neurological signaling and is studied for its r...

Neuropeptides advanced

Opioid Receptor Trafficking: Comprehensive Peptide Reference

Agonist-induced internalization, recycling, and degradation affecting tolerance. This neuropeptide is involved in neurological signaling and is studied for i...

Neuropeptides advanced

Opioid Respiratory Control: Comprehensive Peptide Reference

Role of endogenous opioids in respiratory rhythm generation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fu...

Neuropeptides advanced

Opioid Reward Circuitry: Neuropeptide in Neuroscience Ref...

Endogenous opioids in mesolimbic dopamine reward pathways. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...

Neuropeptides advanced

Opioid Sexual Behavior: Neuropeptide in Neuroscience Refe...

Role of endogenous opioids in sexual arousal and orgasm. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functi...

Neuropeptides intermediate

Opioid Stress Analgesia: Neuropeptide in Neuroscience Ref...

Role of endogenous opioids in stress-induced analgesia. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...

Neuropeptides advanced

Opioid Tolerance Mechanisms: Comprehensive Peptide Reference

Cellular mechanisms of tolerance including desensitization and signaling adaptations. This neuropeptide is involved in neurological signaling and is studied ...

Neuropeptides advanced

Opioid Withdrawal Peptides: Comprehensive Peptide Reference

Role of endogenous opioids in withdrawal including anti-opioid peptide systems. This neuropeptide is involved in neurological signaling and is studied for it...

Neuropeptides advanced

Opioid-Induced Hyperalgesia: Comprehensive Peptide Reference

Paradoxical pain sensitization from chronic opioid use via NMDA pathways. This neuropeptide is involved in neurological signaling and is studied for its role...

Neuropeptides advanced

Opioid-related peptide: Neuropeptide in Neuroscience Refe...

Opioid-related peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Neuropeptides intermediate

Oprelvekin: Oligopeptide Research Reference

Recombinant interleukin-11 for chemotherapy-induced thrombocytopenia, stimulating megakaryocyte proliferation. This peptide or oligopeptide is studied for it...

Hematopoietic Peptides intermediate

Oral Antimicrobial Peptides: Comprehensive Peptide Reference

Salivary antimicrobial peptides including histatins, defensins, and LL-37. This antimicrobial peptide demonstrates activity against pathogens and is studied ...

Antimicrobial Peptides intermediate

Oral delivery system: Oligopeptide Research Reference

Comprehensive reference for oral delivery system, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Oral Delivery: Oligopeptide Research Reference

Delivering peptides orally despite GI degradation challenges. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...

Peptide Therapeutics intermediate

Oral Insulin Formulation: Oligopeptide Research Reference

Oral insulin development including gastric acid protection, intestinal permeation, and hepatic targeting. This peptide or oligopeptide is studied for its bio...

Peptide Drugs advanced

Oral Peptide Delivery Systems: Comprehensive Peptide Refe...

Systems for oral peptide delivery including enzyme inhibitors and permeation enhancers. This peptide or oligopeptide is studied for its biological activity, ...

Drug Delivery intermediate

Oral Peptide Delivery: Oligopeptide Research Reference

Explore strategies and challenges for oral delivery of peptide drugs including permeation enhancers and enteric coatings.

Drug Delivery intermediate

Oral Semaglutide Development History

Development history and formulation science behind oral semaglutide including SNAC technology. This peptide or oligopeptide is studied for its biological act...

GLP-1 Family advanced

Oral Semaglutide Formulation: Comprehensive Peptide Refer...

Oral bioavailability enhancement of semaglutide using SNAC absorption enhancer technology for once-daily oral GLP-1 therapy.

GLP-1 Family advanced

Oral Semaglutide: Oligopeptide Research Reference

Oral semaglutide formulation using SNAC absorption enhancer for gastrointestinal peptide protection. This peptide or oligopeptide is studied for its biologic...

Peptide Drugs intermediate

Oral System 1: Oligopeptide Research Reference

A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

Oral System 2: Oligopeptide Research Reference

A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

Oral System 3: Oligopeptide Research Reference

A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

Oral Tirzepatide: Oligopeptide Research Reference

Oral formulation of dual GIP/GLP-1 agonist tirzepatide using SNAC absorption technology. This peptide or oligopeptide is studied for its biological activity,...

Peptide Drugs advanced

Orange Peptide: Oligopeptide Research Reference

A bioactive peptide derived from orange with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Orellanine: Oligopeptide Research Reference

Orellanine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Orexin → OX1R: Oligopeptide Research Reference

Orexin → OX1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Orexin A (Hypocretin-1): Neuropeptide in Neuroscience Ref...

Orexin A (Hypocretin-1), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Orexin A: Neuropeptide in Neuroscience Reference

Hypothalamic neuropeptide promoting wakefulness and energy homeostasis. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides intermediate

Orexin B: Neuropeptide in Neuroscience Reference

Hypothalamic neuropeptide with wake-promoting activity acting through OX2 receptor. This neuropeptide is involved in neurological signaling and is studied fo...

Neuropeptides intermediate

Orexin: Neuropeptide in Neuroscience Reference

A family of hypothalamic neuropeptides (orexin-A/hypocretin-1 and orexin-B/hypocretin-2) that regulate wakefulness, appetite, and energy homeostasis, with de...

Neuropeptides intermediate

Orforglipron: Oligopeptide Research Reference

Orforglipron, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Organic Precipitation Purification

A purification technique for separating and isolating peptides using Organic Precipitation. This analytical technique provides valuable insights into peptide...

Purification Methods advanced

Oritavancin: Antimicrobial Peptide Reference

Lipoglycopeptide antibiotic with multiple mechanisms of action and 14-day half-life for single-dose treatment of gram-positive infections.

Antimicrobial Peptides intermediate

Orphin: Neuropeptide in Neuroscience Reference

orphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation. Covers molecular mechanisms, biologica...

Neuropeptides intermediate

OSE-2101: Oligopeptide Research Reference

OSE-2101, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

OSM Hormone: Endogenous Peptide Hormone Reference

OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

OSM Peptide Hormone: Endogenous Peptide Hormone Reference

OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

OSM Protein Hormone: Endogenous Peptide Hormone Reference

OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

Osteocalcin 1-14: Peptide Fragment Reference

Comprehensive reference for osteocalcin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 1-20: Peptide Fragment Reference

Comprehensive reference for osteocalcin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 1-30: Peptide Fragment Reference

Comprehensive reference for osteocalcin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 1-40: Peptide Fragment Reference

Comprehensive reference for osteocalcin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 1-49: Peptide Fragment Reference

Comprehensive reference for osteocalcin 1-49 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 15-49: Peptide Fragment Reference

Comprehensive reference for osteocalcin 15-49 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 25-49: Peptide Fragment Reference

Comprehensive reference for osteocalcin 25-49 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 35-49: Peptide Fragment Reference

Comprehensive reference for osteocalcin 35-49 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin 40-49: Peptide Fragment Reference

Comprehensive reference for osteocalcin 40-49 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Osteocalcin Hormone: Endogenous Peptide Hormone Reference

Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Osteocalcin Peptide Hormone: Comprehensive Peptide Reference

Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Osteocalcin Protein Hormone: Comprehensive Peptide Reference

Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Osteocalcin: Structure, Function, and Significance

Osteocalcin is a bone-derived hormone that regulates glucose metabolism, testosterone production, and brain function. Covers molecular mechanisms, biological...

Peptide Hormones intermediate

Osteopontin peptide: Structure, Function, and Significance

RGDSV is an osteopontin-derived peptide involved in bone cell adhesion and remodeling through integrin signaling. Covers molecular mechanisms, biological act...

Structural Peptides intermediate

Osteoporosis and Peptides: Comprehensive Peptide Reference

Learn about peptide-based osteoporosis treatments including PTH analogs and calcitonin for bone density improvement. Covers molecular mechanisms, biological ...

Peptide Therapeutics intermediate

Ostreocin D: Oligopeptide Research Reference

Ostreocin D, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Ostrich Cathelicidin (SdCATH): Comprehensive Peptide Refe...

Comprehensive reference for Ostrich Cathelicidin (SdCATH), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Ostrich Cathelicidin: Oligopeptide Research Reference

Ostrich Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Ostrich Defensin: Oligopeptide Research Reference

Ostrich Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Ovarian Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Ovarian Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...

Disease-Associated Peptides intermediate

Ovarian Cancer: Oligopeptide Research Reference

Malignant transformation of ovarian epithelium. Most lethal gynecologic cancer. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Therapeutics intermediate

overall-survival Resource: Comprehensive Peptide Reference

The overall-survival database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Overdose: Oligopeptide Research Reference

Life-threatening emergencies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Safety intermediate

Ovine Antimicrobial: Oligopeptide Research Reference

Ovine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Mammalian Peptides intermediate

OVX836: Oligopeptide Research Reference

OVX836, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

OX40 Agonist: Oligopeptide Research Reference

OX40 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

Oxidation Cleavable Purification

A purification technique for separating and isolating peptides using Oxidation Cleavable. This analytical technique provides valuable insights into peptide s...

Purification Methods advanced

Oxidative Folding Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Oxidative Folding for producing peptides with specific properties. This analytical technique provides valuable insights into...

Peptide Synthesis Methods advanced

Oxidoreductase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Oxidoreductase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

Oxytocin → OXTR: Oligopeptide Research Reference

Oxytocin → OXTR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Oxytocin 1-5: Peptide Fragment Reference

Comprehensive reference for oxytocin 1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 1-6: Peptide Fragment Reference

Comprehensive reference for oxytocin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 1-7: Peptide Fragment Reference

Comprehensive reference for oxytocin 1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 1-8: Peptide Fragment Reference

Comprehensive reference for oxytocin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 1-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 2-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 2-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 3-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 3-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 4-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 4-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 5-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 5-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 6-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 6-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 7-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 7-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin 8-9: Peptide Fragment Reference

Comprehensive reference for oxytocin 8-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Oxytocin Family Peptides: Oligopeptide Research Reference

Explore oxytocin family peptides and their roles in social bonding, labor, and lactation. This peptide or oligopeptide is studied for its biological activity...

Peptide Families beginner

Oxytocin Hormone: Endogenous Peptide Hormone Reference

Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Oxytocin Intramolecular (Disulfide Bond)

Comprehensive reference for Oxytocin Intramolecular (Disulfide Bond), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Oxytocin Peptide Hormone: Endogenous Peptide Hormone Refe...

Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Oxytocin Protein Hormone: Endogenous Peptide Hormone Refe...

Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Oxytocin Receptor Agonist: Comprehensive Peptide Reference

oxytocin receptor agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Reproductive Peptides intermediate

Oxytocin Receptor Antagonists: Comprehensive Peptide Refe...

Pharmacological inhibition of oxytocin receptors using peptidic antagonists such as atosiban and barusiban for the management of preterm labor and uterine hy...

Drug Development intermediate

Oxytocin Social Bonding: Neuropeptide in Neuroscience Ref...

Central oxytocin effects on pair bonding, trust, and social recognition. This neuropeptide is involved in neurological signaling and is studied for its roles...

Neuropeptides intermediate

Oxytocin: Endogenous Peptide Hormone Reference

A 9-amino acid neuropeptide hormone produced in the hypothalamus and released from the posterior pituitary, mediating uterine contraction, milk ejection, soc...

Peptide Hormones intermediate

Oxytocin: Oligopeptide Research Reference

oxytocin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Drugs intermediate

Oyster Defensin Cg-Defh1: Antimicrobial Peptide Reference

Hemocyte defensin from Pacific oyster with antibacterial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...

Antimicrobial Peptides intermediate

P Aeruginosa Mdr Peptide: Oligopeptide Research Reference

A peptide associated with P Aeruginosa Mdr for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, str...

Microbial Peptides intermediate

P Aeruginosa Peptide: Oligopeptide Research Reference

A peptide associated with P Aeruginosa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...

Microbial Peptides intermediate

P Mirabilis Peptide: Oligopeptide Research Reference

A peptide associated with P Mirabilis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...

Microbial Peptides intermediate

P53 Activator PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting P53 Activator for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

P53 Modulator: Oligopeptide Research Reference

p53 modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

p53 Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

p53 Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

p53 Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

p53 Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

p53 Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

P75NTR Antagonist: Oligopeptide Research Reference

p75NTR antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Neurological Peptides intermediate

PACAP Fragment: Oligopeptide Research Reference

PACAP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Anti-inflammatory Peptides intermediate

PACAP Hormone: Endogenous Peptide Hormone Reference

PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

PACAP Peptide Hormone: Endogenous Peptide Hormone Reference

PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

PACAP Protein Hormone: Endogenous Peptide Hormone Reference

PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

PACAP: Neuropeptide in Neuroscience Reference

Neuropeptide structurally related to VIP with widespread CNS and peripheral effects. This neuropeptide is involved in neurological signaling and is studied f...

Neuropeptides intermediate

PACAP: Neuropeptide in Neuroscience Reference

A 38-amino acid hypothalamic neuropeptide that activates adenylyl cyclase, regulating neurotransmission, neuroprotection, and cardiovascular function through...

Neuropeptides intermediate

PAFP-S: Oligopeptide Research Reference

PAFP-S, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Pain and Peptides: Oligopeptide Research Reference

Discover neuropeptide-based analgesic approaches including opioid peptides and substance P antagonists. This peptide or oligopeptide is studied for its biolo...

Peptide Therapeutics intermediate

Pain Management: Oligopeptide Research Reference

Peptide-based approaches to pain management. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

Painless delivery: Oligopeptide Research Reference

ID. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...

Peptide Patents intermediate

Palicourein: Oligopeptide Research Reference

Palicourein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Palmitoyl Tetrapeptide-7 (Eyeseryl)

Comprehensive reference for Palmitoyl Tetrapeptide-7 (Eyeseryl), a peptide compound with applications in research and therapeutics.

Synthetic Peptides intermediate

Palmitoyl Tripeptide-1 (Matrixyl 3000)

Comprehensive reference for Palmitoyl Tripeptide-1 (Matrixyl 3000), a peptide compound with applications in research and therapeutics.

Synthetic Peptides intermediate

Palytoxin: Oligopeptide Research Reference

Palytoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Pancreatic Cancer Peptides: Comprehensive Peptide Reference

Peptides associated with Pancreatic Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...

Disease-Associated Peptides intermediate

Pancreatic Cancer: Oligopeptide Research Reference

Most lethal common cancer (5-year survival ~12%). KRAS mutations (90%). Usually diagnosed late. Treatments: FOLFIRINOX, gemcitabine/nab-paclitaxel, olaparib ...

Peptide Therapeutics intermediate

Pancreatic Polypeptide Hormone

Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...

Peptide Hormones intermediate

Pancreatic Polypeptide Peptide Hormone

Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...

Peptide Hormones intermediate

Pancreatic Polypeptide Protein Hormone

Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...

Peptide Hormones intermediate

Pancreatic Polypeptide: Oligopeptide Research Reference

Pancreatic Polypeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Paneth Cell Secretion: Antimicrobial Peptide Reference

Regulated exocytosis of defensin granules in response to microbial signals. This antimicrobial peptide demonstrates activity against pathogens and is studied...

Antimicrobial Peptides advanced

Paramagnetic Labeling Synthesis

A peptide synthesis method using Paramagnetic Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolo...

Peptide Synthesis Methods advanced

Paramecium bursaria: Oligopeptide Research Reference

Released upon mechanical stimulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Protist Peptides intermediate

Parasin I: Oligopeptide Research Reference

Parasin I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Parathyroid Hormone Family Peptides

Overview of PTH family peptides including PTH and PTHrP in calcium homeostasis and bone metabolism. This peptide or oligopeptide is studied for its biologica...

Peptide Families intermediate

Parathyroid Hormone: Oligopeptide Research Reference

parathyroid hormone in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Drugs intermediate

Parathyroid Hormone: Oligopeptide Research Reference

PTH for osteoporosis (teriparatide). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Therapeutics intermediate

Pardaxin: Antimicrobial Peptide Reference

pardaxin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...

Antimicrobial Peptides intermediate

Parkinson's and Peptides: Oligopeptide Research Reference

Understand peptide-based strategies for Parkinson's disease including neurotrophic factors and alpha-synuclein modulators.

Peptide Therapeutics advanced

Parkinson's Disease: Oligopeptide Research Reference

Parkinson's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Diseases intermediate

Parkinsons Peptides: Oligopeptide Research Reference

Peptides associated with Parkinsons including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

PARP Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PARP Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

partial-charge Resource: Oligopeptide Research Reference

The partial-charge database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

partial-response Resource: Comprehensive Peptide Reference

The partial-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Pasireotide LAR: Oligopeptide Research Reference

Long-acting pasireotide microspheres for monthly dosing in Cushing disease and acromegaly. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

Pasireotide Somatostatin Analog

Multi-receptor targeted somatostatin analog with high affinity for somatostatin receptor subtype 5 for Cushing's disease.

Therapeutic Peptides advanced

Pasireotide: Oligopeptide Research Reference

pasireotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Pasireotide: Oligopeptide Research Reference

Somatostatin analog with high sst5 affinity for Cushing disease and acromegaly. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Drugs advanced

PCA for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using PCA. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...

Computational Methods advanced

PcTx1: Peptide Toxin in Pharmacology Reference

PcTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...

Venom Peptides intermediate

PD 1 Blocker: Oligopeptide Research Reference

PD 1 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Immune Peptides intermediate

PD L1 Blocker: Oligopeptide Research Reference

PD L1 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

PDB (Sequence): Oligopeptide Research Reference

Protein sequences from the Protein Data Bank. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

PDB (Structure): Oligopeptide Research Reference

3D structural data from the Protein Data Bank. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

PDB Resource: Oligopeptide Research Reference

The PDB database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

PDB: Oligopeptide Research Reference

Protein Data Bank. Repository of 3D structural data for proteins and nucleic acids. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

PDGF Hormone: Endogenous Peptide Hormone Reference

PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

PDGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PDGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

PDGF Peptide Hormone: Endogenous Peptide Hormone Reference

PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

PDGF Protein Hormone: Endogenous Peptide Hormone Reference

PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...

Peptide Hormones intermediate

PDGFR Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PDGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

PDGFR Inhibitor: Oligopeptide Research Reference

PDGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Signaling Peptides intermediate

Pea Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Plant-Derived Peptides intermediate

Peach Peptide: Oligopeptide Research Reference

A bioactive peptide derived from peach with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Peakless Basal Insulin Profiles

Pharmacokinetic concept of flat, peakless basal insulin action profiles achieved by ultra-long-acting insulin analogues.

Insulin Family intermediate

Peanut Peptide: Oligopeptide Research Reference

A bioactive peptide derived from peanut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Pear Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pear with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Pecan Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pecan with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Pediatrics: Oligopeptide Research Reference

Special considerations for peptide drug use in pediatric patients. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Pegbelfermin: Oligopeptide Research Reference

Pegbelfermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Pegfilgrastim: Oligopeptide Research Reference

pegfilgrastim in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Drugs intermediate

Pegfilgrastim: Oligopeptide Research Reference

PEGylated filgrastim with extended half-life for single-dose chemotherapy-induced neutropenia prevention. This peptide or oligopeptide is studied for its bio...

Hematopoietic Peptides intermediate

Peginterferon Alfa: Oligopeptide Research Reference

PEGylated interferon alfa with extended half-life for weekly dosing in hepatitis B, hepatitis C, and cancer treatment. Covers molecular mechanisms, biologica...

Immunomodulatory Peptides intermediate

PEGylated Insulin Analogues: Comprehensive Peptide Reference

Polyethylene glycol conjugation of insulin for half-life extension through increased hydrodynamic radius. This peptide or oligopeptide is studied for its bio...

Insulin Family advanced

PEGylated Insulin Lispro: Oligopeptide Research Reference

PEGylated rapid-acting insulin analog with extended duration providing both prandial and basal coverage. This peptide or oligopeptide is studied for its biol...

Peptide Drugs advanced

PEGylated Liposome Peptide: Comprehensive Peptide Reference

PEG-coated liposomes for extended circulation time and peptide drug targeting. This peptide or oligopeptide is studied for its biological activity, structure...

Drug Delivery intermediate

PEGylation strategy: Oligopeptide Research Reference

Comprehensive reference for pegylation strategy, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

PEGylation Synthesis: Analytical Technique in Peptide Res...

A peptide synthesis method using PEGylation for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...

Peptide Synthesis Methods advanced

PEGylation System 1: Oligopeptide Research Reference

A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

PEGylation System 2: Oligopeptide Research Reference

A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

PEGylation System 3: Oligopeptide Research Reference

A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...

Drug Delivery Systems advanced

Pellenotoxin: Peptide Toxin in Pharmacology Reference

pellenotoxin is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for it...

Venom Peptides intermediate

Pembrolizumab: Oligopeptide Research Reference

pembrolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Drugs intermediate

Pemvidutide: Oligopeptide Research Reference

Dual GLP-1/glucagon receptor agonist using MOMA technology for balanced receptor activation. This peptide or oligopeptide is studied for its biological activ...

Peptide Drugs advanced

Penetratin: Oligopeptide Research Reference

Penetratin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Penicillium chrysogenum: Oligopeptide Research Reference

Binds chitin in fungal cell wall. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Yeast Peptides intermediate

Pentosan Polysulfate: Oligopeptide Research Reference

Semi-synthetic glycosaminoglycan for interstitial cystitis bladder pain syndrome. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Drugs beginner

Pepper Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pepper with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Peptide → BCR (Immune Recognition)

Comprehensive reference for Peptide → BCR (Immune Recognition), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Peptide → MHC Class I (Antigen Presentation)

Comprehensive reference for Peptide → MHC Class I (Antigen Presentation), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Peptide → MHC Class II (Antigen Presentation)

Comprehensive reference for Peptide → MHC Class II (Antigen Presentation), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Peptide → TCR (Immune Recognition)

Comprehensive reference for Peptide → TCR (Immune Recognition), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Peptide 3D Printed Devices: Comprehensive Peptide Reference

3D-printed devices for personalized peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Drug Delivery advanced

Peptide 3D Printing: Oligopeptide Research Reference

Integration of bioactive peptides into 3D-printed scaffolds for tissue engineering and regenerative medicine applications.

Material Science Peptides advanced

Peptide acetylation analysis: Comprehensive Peptide Refer...

Comprehensive reference for peptide acetylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Acetylation Sites: Comprehensive Peptide Reference

Comprehensive overview of N-terminal and lysine acetylation and its role in peptide stability, functional modulation, and pharmacokinetic optimization in the...

Peptide Modifications intermediate

Peptide adsorption: Oligopeptide Research Reference

Comprehensive reference for peptide adsorption, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Aggregation in Biologics

Amyloid formation and non-native peptide aggregation compromise biologics stability, requiring advanced analytical methods and formulation strategies to main...

Drug Development intermediate

Peptide aggregation: Oligopeptide Research Reference

Comprehensive reference for peptide aggregation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Albumin Binding: Oligopeptide Research Reference

Albumin-binding strategies for extending peptide circulating half-life. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Drug Delivery intermediate

Peptide Analgesics: Oligopeptide Research Reference

Explore peptide-based pain therapeutics targeting opioid, nociceptin, and CGRP pathways. This peptide or oligopeptide is studied for its biological activity,...

Peptide Applications intermediate

Peptide Analytical Method Development

Developing and validating analytical methods for peptide characterization and quality control. This peptide or oligopeptide is studied for its biological act...

Peptide Industry advanced

Peptide and Protein Engineering

Journal focused on peptide and protein engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Peptide Therapeutics intermediate

Peptide Anti-Inflammatory Agents

Guide to anti-inflammatory peptides modulating cytokines and immune cell recruitment. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Applications intermediate

Peptide Antibiotics: Oligopeptide Research Reference

Explore antimicrobial peptides as next-generation antibiotics against drug-resistant bacteria. This peptide or oligopeptide is studied for its biological act...

Peptide Applications intermediate

Peptide Anticancer Agents: Comprehensive Peptide Reference

Learn about peptide-based anticancer strategies including targeted delivery and apoptosis induction. This peptide or oligopeptide is studied for its biologic...

Peptide Applications advanced

Peptide Antifungals: Oligopeptide Research Reference

Guide to antifungal peptides targeting fungal membranes for treatment of invasive mycoses. This peptide or oligopeptide is studied for its biological activit...

Peptide Applications intermediate

Peptide Antivirals: Oligopeptide Research Reference

Overview of antiviral peptides disrupting viral entry, fusion, and replication processes. This peptide or oligopeptide is studied for its biological activity...

Peptide Applications intermediate

Peptide aptamer: Oligopeptide Research Reference

Comprehensive reference for peptide aptamer, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Article ${i}: Oligopeptide Research Reference

Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Peptide Autoimmune Therapeutics

Therapeutic peptides for autoimmune disease treatment including tolerogenic peptides and immunomodulatory agents. Covers molecular mechanisms, biological act...

Therapeutic Peptides intermediate

Peptide Backbone 1: Oligopeptide Research Reference

Backbone conformation 1 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 10: Oligopeptide Research Reference

Backbone conformation 10 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 11: Oligopeptide Research Reference

Backbone conformation 11 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 12: Oligopeptide Research Reference

Backbone conformation 12 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 13: Oligopeptide Research Reference

Backbone conformation 13 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 14: Oligopeptide Research Reference

Backbone conformation 14 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 15: Oligopeptide Research Reference

Backbone conformation 15 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 16: Oligopeptide Research Reference

Backbone conformation 16 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 17: Oligopeptide Research Reference

Backbone conformation 17 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 18: Oligopeptide Research Reference

Backbone conformation 18 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 19: Oligopeptide Research Reference

Backbone conformation 19 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 2: Oligopeptide Research Reference

Backbone conformation 2 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 20: Oligopeptide Research Reference

Backbone conformation 20 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 21: Oligopeptide Research Reference

Backbone conformation 21 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 22: Oligopeptide Research Reference

Backbone conformation 22 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 23: Oligopeptide Research Reference

Backbone conformation 23 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 24: Oligopeptide Research Reference

Backbone conformation 24 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 25: Oligopeptide Research Reference

Backbone conformation 25 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 26: Oligopeptide Research Reference

Backbone conformation 26 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 27: Oligopeptide Research Reference

Backbone conformation 27 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 28: Oligopeptide Research Reference

Backbone conformation 28 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 29: Oligopeptide Research Reference

Backbone conformation 29 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 3: Oligopeptide Research Reference

Backbone conformation 3 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 30: Oligopeptide Research Reference

Backbone conformation 30 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 31: Oligopeptide Research Reference

Backbone conformation 31 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 32: Oligopeptide Research Reference

Backbone conformation 32 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 33: Oligopeptide Research Reference

Backbone conformation 33 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 34: Oligopeptide Research Reference

Backbone conformation 34 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 35: Oligopeptide Research Reference

Backbone conformation 35 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 36: Oligopeptide Research Reference

Backbone conformation 36 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 37: Oligopeptide Research Reference

Backbone conformation 37 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 38: Oligopeptide Research Reference

Backbone conformation 38 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 39: Oligopeptide Research Reference

Backbone conformation 39 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 4: Oligopeptide Research Reference

Backbone conformation 4 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 40: Oligopeptide Research Reference

Backbone conformation 40 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 41: Oligopeptide Research Reference

Backbone conformation 41 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 42: Oligopeptide Research Reference

Backbone conformation 42 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 43: Oligopeptide Research Reference

Backbone conformation 43 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 44: Oligopeptide Research Reference

Backbone conformation 44 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 45: Oligopeptide Research Reference

Backbone conformation 45 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 46: Oligopeptide Research Reference

Backbone conformation 46 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 47: Oligopeptide Research Reference

Backbone conformation 47 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 48: Oligopeptide Research Reference

Backbone conformation 48 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 49: Oligopeptide Research Reference

Backbone conformation 49 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 5: Oligopeptide Research Reference

Backbone conformation 5 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 50: Oligopeptide Research Reference

Backbone conformation 50 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Backbone Conformations intermediate

Peptide Backbone 6: Oligopeptide Research Reference

Backbone conformation 6 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 7: Oligopeptide Research Reference

Backbone conformation 7 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 8: Oligopeptide Research Reference

Backbone conformation 8 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide Backbone 9: Oligopeptide Research Reference

Backbone conformation 9 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Backbone Conformations intermediate

Peptide backbone modification: Comprehensive Peptide Refe...

Comprehensive reference for peptide backbone modification, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide bioconjugation: Oligopeptide Research Reference

Comprehensive reference for peptide bioconjugation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Biomarker Diagnostics: Comprehensive Peptide Refe...

Use of peptides and peptide fragments as diagnostic biomarkers in clinical laboratory testing and disease monitoring. Covers molecular mechanisms, biological...

Diagnostics intermediate

Peptide Biomarkers: Oligopeptide Research Reference

Peptides as diagnostic and prognostic biomarkers for disease detection and monitoring. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Future intermediate

Peptide Biosimilar Delivery: Comprehensive Peptide Reference

Delivery considerations for biosimilar peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Drug Delivery intermediate

Peptide Biosimilar Development

Regulatory and scientific considerations for developing biosimilar peptide therapeutics. This peptide or oligopeptide is studied for its biological activity,...

Biosimilars intermediate

Peptide Biosimilar Regulation: Comprehensive Peptide Refe...

Navigate regulatory pathways for peptide biosimilars including comparative analytical and clinical studies. This peptide or oligopeptide is studied for its b...

Regulatory advanced

Peptide Biosimilars: Oligopeptide Research Reference

Biosimilar development for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Peptide Therapeutics intermediate

Peptide biotinylation: Oligopeptide Research Reference

Comprehensive reference for peptide biotinylation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Blood-Brain Barrier: Comprehensive Peptide Reference

Strategies for delivering peptides across the blood-brain barrier. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Drug Delivery advanced

Peptide bond theory (1902), Fischer's amino acid research

Peptide bond theory (1902), Fischer's amino acid research is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Peptide C-terminal modification

Comprehensive reference for peptide c-terminal modification, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Cancer Market: Oligopeptide Research Reference

Market analysis for peptide-based cancer therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...

Peptide Therapeutics intermediate

Peptide carbonylation analysis

Comprehensive reference for peptide carbonylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Cardiovascular Therapeutics

Therapeutic peptides targeting cardiovascular diseases including natriuretic peptides, ACE inhibitors, and anticoagulants.

Therapeutic Peptides intermediate

Peptide Career Paths: Oligopeptide Research Reference

Career opportunities and professional paths in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Industry beginner

Peptide CDMO Industry: Oligopeptide Research Reference

Contract development and manufacturing organizations specializing in peptide production. This peptide or oligopeptide is studied for its biological activity,...

Peptide Industry beginner

Peptide Chemistry and Drug Design

Resource on peptide chemistry principles and drug design applications. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Therapeutics intermediate

Peptide citrullination analysis

Comprehensive reference for peptide citrullination analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Class: Oligopeptide Research Reference

Clinical Significance. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Bacterial Peptides intermediate

Peptide cleavage: Oligopeptide Research Reference

Comprehensive reference for peptide cleavage, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Clinical Trial Design: Comprehensive Peptide Refe...

Design considerations for clinical trials of peptide therapeutics including dosing, endpoints, and safety monitoring. Covers molecular mechanisms, biological...

Clinical Development intermediate

Peptide Clinical Trials: Oligopeptide Research Reference

Clinical trial phases for peptide drugs: Phase I (safety, dosing, PK), Phase II (efficacy, dose-finding), Phase III (confirmatory, large-scale), Phase IV (po...

Peptide Therapeutics intermediate

Peptide clipping: Oligopeptide Research Reference

Comprehensive reference for peptide clipping, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide coil assembly: Oligopeptide Research Reference

Comprehensive reference for peptide coil assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Combination Delivery: Comprehensive Peptide Refer...

Co-delivery systems for multiple peptide drugs in single formulation. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Drug Delivery advanced

Peptide Companies Overview: Comprehensive Peptide Reference

Major pharmaceutical and biotechnology companies developing peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Industry beginner

Peptide Conference Calendar: Comprehensive Peptide Reference

Major conferences and events in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Industry beginner

Peptide Conjugation Synthesis: Comprehensive Peptide Refe...

A peptide synthesis method using Peptide Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...

Peptide Synthesis Methods advanced

Peptide Controlled Release: Comprehensive Peptide Reference

Controlled release technologies for maintaining therapeutic peptide levels. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Drug Delivery intermediate

Peptide Cosmeceuticals: Oligopeptide Research Reference

Bioactive peptides used in cosmetic and skincare products for anti-aging, skin brightening, and wound healing applications.

Cosmetic Peptides beginner

Peptide Crop Protection: Oligopeptide Research Reference

Use of antimicrobial and insecticidal peptides as biopesticides and crop protection agents in agriculture. This peptide or oligopeptide is studied for its bi...

Agricultural Peptides intermediate

Peptide cryo-EM: Oligopeptide Research Reference

Comprehensive reference for peptide cryo-em, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Crystallization Techniques

Guide to peptide crystallization methods including hanging drop, sitting drop, and microbatch approaches. This peptide or oligopeptide is studied for its bio...

Peptide Analysis advanced

Peptide crystallization: Oligopeptide Research Reference

Comprehensive reference for peptide crystallization, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide cyclization: Oligopeptide Research Reference

Comprehensive reference for peptide cyclization, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide deamidation analysis: Comprehensive Peptide Refer...

Comprehensive reference for peptide deamidation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide degradation: Oligopeptide Research Reference

Comprehensive reference for peptide degradation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Dendrimer Conjugates: Comprehensive Peptide Refer...

Dendrimer conjugation for multivalent peptide display and delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Drug Delivery advanced

Peptide Dermatological Drug Development

Development challenges for topical peptide therapeutics including skin penetration optimization. This peptide or oligopeptide is studied for its biological a...

Drug Development advanced

Peptide Dermatological Therapeutics

Therapeutic peptides for skin conditions including wound healing, anti-scarring, and anti-inflammatory treatments. Covers molecular mechanisms, biological ac...

Therapeutic Peptides intermediate

Peptide desorption: Oligopeptide Research Reference

Comprehensive reference for peptide desorption, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Diagnostic Marker diagnostic-marker-1

Comprehensive reference for peptide diagnostic marker diagnostic-marker-1, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-10

Comprehensive reference for peptide diagnostic marker diagnostic-marker-10, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-11

Comprehensive reference for peptide diagnostic marker diagnostic-marker-11, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-12

Comprehensive reference for peptide diagnostic marker diagnostic-marker-12, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-13

Comprehensive reference for peptide diagnostic marker diagnostic-marker-13, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-14

Comprehensive reference for peptide diagnostic marker diagnostic-marker-14, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-15

Comprehensive reference for peptide diagnostic marker diagnostic-marker-15, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-16

Comprehensive reference for peptide diagnostic marker diagnostic-marker-16, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-17

Comprehensive reference for peptide diagnostic marker diagnostic-marker-17, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-18

Comprehensive reference for peptide diagnostic marker diagnostic-marker-18, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-19

Comprehensive reference for peptide diagnostic marker diagnostic-marker-19, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-2

Comprehensive reference for peptide diagnostic marker diagnostic-marker-2, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-20

Comprehensive reference for peptide diagnostic marker diagnostic-marker-20, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-21

Comprehensive reference for peptide diagnostic marker diagnostic-marker-21, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-22

Comprehensive reference for peptide diagnostic marker diagnostic-marker-22, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-23

Comprehensive reference for peptide diagnostic marker diagnostic-marker-23, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-24

Comprehensive reference for peptide diagnostic marker diagnostic-marker-24, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-25

Comprehensive reference for peptide diagnostic marker diagnostic-marker-25, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-26

Comprehensive reference for peptide diagnostic marker diagnostic-marker-26, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-27

Comprehensive reference for peptide diagnostic marker diagnostic-marker-27, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-28

Comprehensive reference for peptide diagnostic marker diagnostic-marker-28, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-29

Comprehensive reference for peptide diagnostic marker diagnostic-marker-29, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-3

Comprehensive reference for peptide diagnostic marker diagnostic-marker-3, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-30

Comprehensive reference for peptide diagnostic marker diagnostic-marker-30, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-31

Comprehensive reference for peptide diagnostic marker diagnostic-marker-31, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-32

Comprehensive reference for peptide diagnostic marker diagnostic-marker-32, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-33

Comprehensive reference for peptide diagnostic marker diagnostic-marker-33, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-34

Comprehensive reference for peptide diagnostic marker diagnostic-marker-34, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-35

Comprehensive reference for peptide diagnostic marker diagnostic-marker-35, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-36

Comprehensive reference for peptide diagnostic marker diagnostic-marker-36, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-37

Comprehensive reference for peptide diagnostic marker diagnostic-marker-37, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-38

Comprehensive reference for peptide diagnostic marker diagnostic-marker-38, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-39

Comprehensive reference for peptide diagnostic marker diagnostic-marker-39, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-4

Comprehensive reference for peptide diagnostic marker diagnostic-marker-4, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-40

Comprehensive reference for peptide diagnostic marker diagnostic-marker-40, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-5

Comprehensive reference for peptide diagnostic marker diagnostic-marker-5, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-6

Comprehensive reference for peptide diagnostic marker diagnostic-marker-6, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-7

Comprehensive reference for peptide diagnostic marker diagnostic-marker-7, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-8

Comprehensive reference for peptide diagnostic marker diagnostic-marker-8, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostic Marker diagnostic-marker-9

Comprehensive reference for peptide diagnostic marker diagnostic-marker-9, covering molecular structure, pharmacological properties, receptor interactions,

Diagnostic Peptides intermediate

Peptide Diagnostics Future: Comprehensive Peptide Reference

Emerging peptide-based diagnostic technologies for next-generation clinical testing. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Future intermediate

Peptide Diagnostics: Oligopeptide Research Reference

Explore peptide-based diagnostic tools for biomarker detection and disease monitoring. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Applications intermediate

Peptide diffraction: Oligopeptide Research Reference

Comprehensive reference for peptide diffraction, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide disordered: Oligopeptide Research Reference

Comprehensive reference for peptide disordered, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide DMFs and IMPs: Oligopeptide Research Reference

Understand Drug Master File and Investigational Medicinal Product dossier requirements for peptide APIs. This peptide or oligopeptide is studied for its biol...

Regulatory advanced

Peptide Drug 505(b)(2) Development

Development pathway for modified peptide drug products using the FDA 505(b)(2) regulatory pathway. This peptide or oligopeptide is studied for its biological...

Regulatory Affairs advanced

Peptide Drug Cleaning Validation

Validation of cleaning procedures for peptide manufacturing equipment to prevent cross-contamination. This peptide or oligopeptide is studied for its biologi...

Manufacturing intermediate

Peptide Drug Comparability Studies

Requirements for demonstrating comparability of peptide drug products after manufacturing changes. This peptide or oligopeptide is studied for its biological...

Quality Assurance advanced

Peptide Drug Conjugates: Oligopeptide Research Reference

An overview of peptide-drug conjugates as targeted therapeutics, covering linker chemistry, payload selection, and mechanisms of intracellular drug release.

Drug Development intermediate

Peptide Drug Connected Devices

Integration of digital technology with peptide drug delivery devices for monitoring and adherence. This peptide or oligopeptide is studied for its biological...

Digital Health advanced

Peptide Drug Container Closure Systems

Selection and qualification of container closure systems for peptide drug products. This peptide or oligopeptide is studied for its biological activity, stru...

Packaging intermediate

Peptide Drug Continuous Manufacturing

Transition from batch to continuous manufacturing for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Manufacturing advanced

Peptide Drug Delivery Future: Comprehensive Peptide Refer...

Next-generation delivery technologies for peptide therapeutics beyond traditional injections. This peptide or oligopeptide is studied for its biological acti...

Peptide Future intermediate

Peptide Drug Device Development

Development of drug-device combination products including autoinjectors and pen injectors. This peptide or oligopeptide is studied for its biological activit...

Device Development advanced

Peptide Drug Digital Twins: Comprehensive Peptide Reference

Digital twin technology for peptide drug development and manufacturing processes. This peptide or oligopeptide is studied for its biological activity, struct...

Digital Manufacturing advanced

Peptide Drug Excipient Compatibility

Studies assessing the compatibility of peptide active ingredients with pharmaceutical excipients. This peptide or oligopeptide is studied for its biological ...

Formulation Development intermediate

Peptide Drug Future Perspectives

Emerging trends and future directions in peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Drug Development intermediate

Peptide Drug Pricing: Oligopeptide Research Reference

Factors influencing the pricing of peptide therapeutics and market dynamics. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Industry beginner

Peptide Drug Reprocessing: Comprehensive Peptide Reference

Procedures and controls for reprocessing and reworking peptide drug products during manufacturing. This peptide or oligopeptide is studied for its biological...

Manufacturing intermediate

Peptide Drug Stability-Indicating Methods

Development and validation of analytical methods that detect changes in peptide drug quality over time. This peptide or oligopeptide is studied for its biolo...

Analytical Development advanced

Peptide Drug Sustainability: Comprehensive Peptide Reference

Environmental and social sustainability in peptide drug manufacturing, packaging, and distribution. This peptide or oligopeptide is studied for its biologica...

Sustainability intermediate

Peptide E: Neuropeptide in Neuroscience Reference

peptide-E is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Peptide embedding: Oligopeptide Research Reference

Comprehensive reference for peptide embedding, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Encapsulation Efficiency

Methods for measuring and optimizing peptide encapsulation in delivery systems. This peptide or oligopeptide is studied for its biological activity, structur...

Drug Delivery intermediate

Peptide encapsulation: Oligopeptide Research Reference

Comprehensive reference for peptide encapsulation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Endocrine Therapeutics

Therapeutic peptides for endocrine disorders including diabetes, thyroid disease, and adrenal insufficiency. This peptide or oligopeptide is studied for its ...

Therapeutic Peptides intermediate

Peptide entrapment: Oligopeptide Research Reference

Comprehensive reference for peptide entrapment, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Environmental Remediation

Use of metal-binding and biosurfactant peptides for heavy metal remediation and environmental cleanup applications. Covers molecular mechanisms, biological a...

Environmental Peptides intermediate

Peptide Excipient Qualification

Understand excipient selection and qualification requirements for peptide drug product formulation. This peptide or oligopeptide is studied for its biologica...

Regulatory intermediate

Peptide F: Neuropeptide in Neuroscience Reference

peptide-F is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Peptide Fc Fusion Technology: Comprehensive Peptide Refer...

Fc fusion protein technology for extending peptide drug half-life. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Drug Delivery intermediate

Peptide fiber assembly: Oligopeptide Research Reference

Comprehensive reference for peptide fiber assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide fibril: Oligopeptide Research Reference

Comprehensive reference for peptide fibril, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide fluorescent labeling: Comprehensive Peptide Refer...

Comprehensive reference for peptide fluorescent labeling, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Food Supplements: Oligopeptide Research Reference

Bioactive peptides used in nutritional supplements for muscle recovery, joint health, and metabolic support. This peptide or oligopeptide is studied for its ...

Nutritional Peptides beginner

Peptide formulation: Oligopeptide Research Reference

Comprehensive reference for peptide formulation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide freeze-drying: Oligopeptide Research Reference

Comprehensive reference for peptide freeze-drying, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Gastrointestinal Therapeutics

Therapeutic peptides for GI conditions including IBD, IBS, and motility disorders. This peptide or oligopeptide is studied for its biological activity, struc...

Therapeutic Peptides intermediate

Peptide Gene Delivery: Oligopeptide Research Reference

Peptide vectors for nucleic acid delivery in gene therapy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Drug Delivery advanced

Peptide Gene Therapy: Oligopeptide Research Reference

Peptides as delivery vehicles and modulators in gene therapy applications. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Future advanced

Peptide Generic Market: Oligopeptide Research Reference

The landscape of generic and biosimilar peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...

Peptide Industry intermediate

Peptide glass transition: Oligopeptide Research Reference

Comprehensive reference for peptide glass transition, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide glycosylation analysis

Comprehensive reference for peptide glycosylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide glypiation: Oligopeptide Research Reference

Comprehensive reference for peptide glypiation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Health Economics: Oligopeptide Research Reference

Health economic evaluation of peptide therapeutics including cost-effectiveness and market access. This peptide or oligopeptide is studied for its biological...

Health Economics intermediate

Peptide helix assembly: Oligopeptide Research Reference

Comprehensive reference for peptide helix assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Hematological Therapeutics

Therapeutic peptides for blood disorders including anemia, thrombocytopenia, and coagulopathies. This peptide or oligopeptide is studied for its biological a...

Therapeutic Peptides intermediate

Peptide Hepatic Therapeutics: Comprehensive Peptide Refer...

Therapeutic peptides for liver diseases including hepatitis, cirrhosis, and metabolic liver conditions. This peptide or oligopeptide is studied for its biolo...

Therapeutic Peptides intermediate

Peptide Hormone Replacement Therapy

Clinical use of peptide hormones for replacement therapy in endocrine deficiency disorders. This endogenous peptide hormone plays important roles in physiolo...

Therapeutic Peptides beginner

Peptide hydrocarbon stapling: Comprehensive Peptide Refer...

Comprehensive reference for peptide hydrocarbon stapling, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Hydrogel Network: Oligopeptide Research Reference

Engineering hydrogel networks for controlled peptide release kinetics. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Drug Delivery advanced

Peptide hydrogel self-assembly

Comprehensive reference for peptide hydrogel self-assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Hydrogels: Oligopeptide Research Reference

A review of self-assembling peptide hydrogels including RADA16 and EAK16, covering self-assembly mechanisms, mechanical properties, and tissue engineering ap...

Peptide Applications intermediate

Peptide hydrolysis: Oligopeptide Research Reference

Comprehensive reference for peptide hydrolysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Imaging Agents: Oligopeptide Research Reference

Guide to radiolabeled peptides as imaging agents in PET, SPECT, and fluorescence imaging. This peptide or oligopeptide is studied for its biological activity...

Peptide Applications advanced

Peptide immobilization: Oligopeptide Research Reference

Comprehensive reference for peptide immobilization, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Immunomodulators: Oligopeptide Research Reference

Overview of immunomodulatory peptides enhancing or suppressing immune responses therapeutically. This peptide or oligopeptide is studied for its biological a...

Peptide Applications advanced

Peptide Immunotherapy: Oligopeptide Research Reference

Peptide-based approaches to modulate immune responses in cancer and autoimmune diseases. This peptide or oligopeptide is studied for its biological activity,...

Peptide Future advanced

Peptide Implant Device: Oligopeptide Research Reference

Non-biodegradable implant devices for year-long peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Drug Delivery intermediate

Peptide Industry Partnerships: Comprehensive Peptide Refe...

Strategic partnerships and collaborations in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Industry beginner

Peptide Infectious Disease Therapeutics

Therapeutic peptides for infectious diseases including antivirals, antifungals, and antiparasitic agents. This peptide or oligopeptide is studied for its bio...

Therapeutic Peptides intermediate

Peptide Inhaler Devices: Oligopeptide Research Reference

Guide to dry powder inhaler and metered-dose devices optimized for pulmonary peptide delivery. This peptide or oligopeptide is studied for its biological act...

Drug Delivery intermediate

Peptide Intellectual Property Strategy

Strategic approaches to protecting peptide innovations through patents and trade secrets. This peptide or oligopeptide is studied for its biological activity...

Peptide Industry advanced

Peptide intrinsically disordered

Comprehensive reference for peptide intrinsically disordered, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Investment: Oligopeptide Research Reference

Venture capital, M&A, and public market investment trends in peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Industry beginner

Peptide isomerization analysis

Comprehensive reference for peptide isomerization analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide isostere: Oligopeptide Research Reference

Comprehensive reference for peptide isostere, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Labeling Requirements: Comprehensive Peptide Refe...

Learn regulatory requirements for peptide drug labeling including package inserts and prescribing information. This peptide or oligopeptide is studied for it...

Regulatory intermediate

Peptide labeling: Oligopeptide Research Reference

Comprehensive reference for peptide labeling, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Libraries: Oligopeptide Research Reference

Collections of diverse peptides for screening and drug discovery. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Peptide Lipid Conjugates: Oligopeptide Research Reference

Lipid conjugation for membrane anchoring and sustained peptide release. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Drug Delivery intermediate

Peptide lipidation: Oligopeptide Research Reference

Comprehensive reference for peptide lipidation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide loop assembly: Oligopeptide Research Reference

Comprehensive reference for peptide loop assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Lyophilization: Oligopeptide Research Reference

Lyophilization protocols for stabilizing peptide drugs in solid form. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Drug Delivery intermediate

Peptide Manufacturing Scale-Up

Challenges and solutions for scaling peptide synthesis from laboratory to commercial manufacturing. This peptide or oligopeptide is studied for its biologica...

Manufacturing intermediate

Peptide Manufacturing: Oligopeptide Research Reference

Manufacturing methods: SPPS (Fmoc strategy, most common), liquid-phase synthesis (large-scale), recombinant production (E. coli, yeast, mammalian cells), enz...

Peptide Therapeutics intermediate

Peptide Mapping: Analytical Technique in Peptide Research

Learn peptide mapping strategies for characterizing protein primary structure and identifying post-translational modifications.

Peptide Analysis intermediate

Peptide Market Access Strategies

Pricing, reimbursement, and market access strategies for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Industry intermediate

Peptide Market Size: Oligopeptide Research Reference

Current global peptide therapeutics market size and growth projections. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Industry beginner

Peptide Market Trends: Oligopeptide Research Reference

Market trends in peptide therapeutics including growth drivers and opportunities. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide Therapeutics intermediate

Peptide mass spectrometry: Comprehensive Peptide Reference

Comprehensive reference for peptide mass spectrometry, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Metabolism in the Liver

An examination of hepatic peptide metabolism including extraction mechanisms, cytochrome P450 involvement, peptidase activity, and implications for first-pas...

Drug Development advanced

Peptide methylation analysis: Comprehensive Peptide Refer...

Comprehensive reference for peptide methylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Methylation Sites: Comprehensive Peptide Reference

Learn about arginine and lysine methylation in peptide epigenetic regulation. This modification affects peptide stability, receptor binding, and biological a...

Peptide Modifications advanced

Peptide micelle assembly: Oligopeptide Research Reference

Comprehensive reference for peptide micelle assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Microarrays: Analytical Technique in Peptide Rese...

Learn about high-throughput peptide microarray platforms for screening binding interactions and enzyme substrates. Covers molecular mechanisms, biological ac...

Peptide Analysis intermediate

Peptide Microchip Devices: Comprehensive Peptide Reference

Microchip-controlled devices for programmable peptide delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Drug Delivery advanced

Peptide Microneedle Patches: Comprehensive Peptide Reference

Transdermal microneedle patch technology for painless peptide delivery through the stratum corneum barrier. This peptide or oligopeptide is studied for its b...

Drug Delivery intermediate

Peptide Microsphere Depot: Comprehensive Peptide Reference

Biodegradable microspheres forming sustained-release depots for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure...

Drug Delivery intermediate

Peptide mimetic: Oligopeptide Research Reference

Comprehensive reference for peptide mimetic, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Mimetics: Post-Translational Modification Reference

Guide to peptide mimetics that replicate natural peptide functions with enhanced properties. This modification affects peptide stability, receptor binding, a...

Peptide Modifications intermediate

Peptide misfolding: Oligopeptide Research Reference

Comprehensive reference for peptide misfolding, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide modification analysis: Comprehensive Peptide Refe...

Comprehensive reference for peptide modification analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Molecular Docking: Comprehensive Peptide Reference

Computational methods for predicting peptide-receptor binding poses and affinities in drug design and optimization. Covers molecular mechanisms, biological a...

Computational Peptides advanced

Peptide molten globule: Oligopeptide Research Reference

Comprehensive reference for peptide molten globule, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Musculoskeletal Therapeutics

Therapeutic peptides for bone, joint, and muscle conditions including osteoporosis and sarcopenia. This peptide or oligopeptide is studied for its biological...

Therapeutic Peptides intermediate

Peptide Myristoylation Sites: Comprehensive Peptide Refer...

Explore N-myristoylation in peptide membrane association and protein interactions. This modification affects peptide stability, receptor binding, and biologi...

Peptide Modifications advanced

Peptide myristoylation: Oligopeptide Research Reference

Comprehensive reference for peptide myristoylation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide N-terminal modification

Comprehensive reference for peptide n-terminal modification, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Nanofiber Delivery: Comprehensive Peptide Reference

Self-assembling peptide nanofibers for localized drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Drug Delivery advanced

Peptide Nanomedicine: Oligopeptide Research Reference

Peptide Nanomedicine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Drug Development intermediate

Peptide nanoparticle self-assembly

Comprehensive reference for peptide nanoparticle self-assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Nanotechnology: Oligopeptide Research Reference

Self-assembling peptides and nanostructures for biomedical and materials applications. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Future advanced

Peptide NDA Submission: Oligopeptide Research Reference

Guide to compiling a complete New Drug Application for peptide therapeutics including CMC and clinical sections. Covers molecular mechanisms, biological acti...

Regulatory advanced

Peptide Neurological Therapeutics

Therapeutic peptides targeting neurological conditions including pain, neurodegenerative diseases, and psychiatric disorders.

Therapeutic Peptides intermediate

Peptide nitrosylation analysis

Comprehensive reference for peptide nitrosylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide NMR: Oligopeptide Research Reference

Comprehensive reference for peptide nmr, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Nucleic Acid Detection

Learn methods for detecting and characterizing peptide nucleic acid hybrids using gel shift and fluorescence assays. Covers molecular mechanisms, biological ...

Peptide Analysis intermediate

Peptide nucleic acid hybrid: Comprehensive Peptide Reference

Comprehensive reference for peptide nucleic acid hybrid, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide nucleic acid: Oligopeptide Research Reference

Comprehensive reference for peptide nucleic acid, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Ophthalmic Drug Development

Development of peptide therapeutics for eye diseases including formulation challenges. This peptide or oligopeptide is studied for its biological activity, s...

Drug Development advanced

Peptide Ophthalmic Therapeutics

Therapeutic peptides for eye diseases including glaucoma, macular degeneration, and dry eye syndrome. This peptide or oligopeptide is studied for its biologi...

Therapeutic Peptides intermediate

Peptide oxidation analysis: Comprehensive Peptide Reference

Comprehensive reference for peptide oxidation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Palmitoylation Sites: Comprehensive Peptide Refer...

Learn about S-palmitoylation in peptide membrane targeting and signal transduction. This modification affects peptide stability, receptor binding, and biolog...

Peptide Modifications advanced

Peptide palmitoylation: Oligopeptide Research Reference

Comprehensive reference for peptide palmitoylation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Patent Strategy: Oligopeptide Research Reference

Intellectual property strategy for peptide drugs including composition of matter and formulation patents. This peptide or oligopeptide is studied for its bio...

Intellectual Property advanced

Peptide Patents: Oligopeptide Research Reference

Intellectual property protection for peptide drugs, formulations, synthesis methods, and therapeutic applications. Key patent categories: composition of matt...

Peptide Therapeutics intermediate

Peptide Patents: Oligopeptide Research Reference

Intellectual property strategies and patent landscape for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Industry intermediate

Peptide PEG conjugation: Oligopeptide Research Reference

Comprehensive reference for peptide peg conjugation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide PEGylation Strategies: Comprehensive Peptide Refe...

PEG conjugation strategies for extending peptide half-life in vivo. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Drug Delivery intermediate

Peptide Pharmacovigilance: Comprehensive Peptide Reference

Post-market safety monitoring and adverse event reporting for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, stru...

Drug Safety intermediate

Peptide phosphorylation analysis

Comprehensive reference for peptide phosphorylation analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Phosphorylation Sites: Comprehensive Peptide Refe...

Guide to phosphorylation of serine, threonine, and tyrosine residues in peptide signaling. This modification affects peptide stability, receptor binding, and...

Peptide Modifications intermediate

Peptide Precision Medicine: Comprehensive Peptide Reference

Tailoring peptide therapeutics to individual patient profiles and biomarkers. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Future intermediate

Peptide Prenylation Sites: Comprehensive Peptide Reference

Overview of farnesyl and geranylgeranyl modifications anchoring peptides to membranes. This modification affects peptide stability, receptor binding, and bio...

Peptide Modifications advanced

Peptide prenylation: Oligopeptide Research Reference

Comprehensive reference for peptide prenylation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Quality Control: Oligopeptide Research Reference

Analytical methods and specifications for peptide quality control including identity, purity, potency, and stability testing.

Quality Assurance intermediate

Peptide quaternary structure: Comprehensive Peptide Refer...

Comprehensive reference for peptide quaternary structure, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide racemization analysis: Comprehensive Peptide Refe...

Comprehensive reference for peptide racemization analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide radioactive labeling: Comprehensive Peptide Refer...

Comprehensive reference for peptide radioactive labeling, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Radioligand Therapy: Comprehensive Peptide Reference

Targeted radionuclide therapy using radiolabeled peptides for peptide receptor radionuclide therapy in neuroendocrine tumors.

Nuclear Medicine advanced

Peptide random coil: Oligopeptide Research Reference

Comprehensive reference for peptide random coil, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Rare Disease Therapeutics

Therapeutic peptides for rare diseases including enzyme replacement therapies and hormone replacement. This peptide or oligopeptide is studied for its biolog...

Therapeutic Peptides intermediate

Peptide Regulatory Approval Pathways

Navigating the regulatory pathways for peptide drug approval in major markets. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Industry advanced

Peptide Regulatory Landscape: Comprehensive Peptide Refer...

Global regulatory frameworks governing peptide drug approval and marketing. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide Industry intermediate

Peptide Regulatory Requirements

Regulatory framework for peptide drug development including CMC requirements. This peptide or oligopeptide is studied for its biological activity, structure-...

Regulatory Affairs intermediate

Peptide Release Kinetics: Oligopeptide Research Reference

Mathematical modeling of peptide release from delivery systems. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Drug Delivery advanced

Peptide Renal Therapeutics: Comprehensive Peptide Reference

Therapeutic peptides for kidney diseases including erythropoiesis-stimulating agents and phosphate binders. This peptide or oligopeptide is studied for its b...

Therapeutic Peptides intermediate

Peptide Research in Animal Models

Use of animal models for studying peptide pharmacology, toxicology, and efficacy in preclinical drug development. Covers molecular mechanisms, biological act...

Preclinical Research intermediate

Peptide Respiratory Therapeutics

Therapeutic peptides for respiratory conditions including asthma, COPD, and pulmonary infections. This peptide or oligopeptide is studied for its biological ...

Therapeutic Peptides intermediate

Peptide Responsive Delivery: Comprehensive Peptide Reference

Stimuli-responsive delivery systems for on-demand peptide release. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Drug Delivery advanced

Peptide Scaffold System 1: Comprehensive Peptide Reference

A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Peptide Scaffold System 2: Comprehensive Peptide Reference

A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Peptide Scaffold System 3: Comprehensive Peptide Reference

A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Peptide scaffold: Oligopeptide Research Reference

Comprehensive reference for peptide scaffold, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Self-Assembly: Oligopeptide Research Reference

Peptide self-assembly into nanostructures for drug delivery applications. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Drug Delivery advanced

Peptide Self-Healing Materials

Self-assembling peptide materials with intrinsic self-healing properties for biomedical and structural applications. Covers molecular mechanisms, biological ...

Material Science Peptides advanced

Peptide sequencing: Oligopeptide Research Reference

Comprehensive reference for peptide sequencing, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide sheet assembly: Oligopeptide Research Reference

Comprehensive reference for peptide sheet assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide shelf life: Oligopeptide Research Reference

Comprehensive reference for peptide shelf life, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide side-chain modification

Comprehensive reference for peptide side-chain modification, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Spray-Drying: Oligopeptide Research Reference

Spray-drying technology for producing peptide microparticles for inhalation. This peptide or oligopeptide is studied for its biological activity, structure-a...

Drug Delivery intermediate

Peptide Stability GI Tract: Comprehensive Peptide Reference

Strategies for protecting peptides from gastrointestinal enzymatic degradation. This peptide or oligopeptide is studied for its biological activity, structur...

Drug Delivery intermediate

Peptide Stability in Blood: Comprehensive Peptide Reference

A comprehensive review of factors affecting peptide stability in circulation, including protease degradation pathways, half-life determination methods, and f...

Drug Development intermediate

Peptide Stability in Formulation

Pharmaceutical strategies for enhancing peptide drug stability including lyophilization, surfactant selection, antioxidant incorporation, and pH optimization.

Drug Development intermediate

Peptide Stability in Freeze-Thaw Cycles

Freeze-thaw cycles induce peptide aggregation and denaturation requiring cryoprotectant optimization and formulation strategies to maintain structural integr...

Drug Development intermediate

Peptide stability: Oligopeptide Research Reference

Comprehensive reference for peptide stability, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide stapling: Oligopeptide Research Reference

Comprehensive reference for peptide stapling, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide Startup Ecosystem: Comprehensive Peptide Reference

Overview of the peptide startup landscape including companies and technology platforms. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Therapeutics intermediate

Peptide SUMOylation Sites: Comprehensive Peptide Reference

Guide to SUMO modification of peptides in nuclear transport and transcriptional regulation. This modification affects peptide stability, receptor binding, an...

Peptide Modifications advanced

Peptide Supply Chain Management

Managing the complex supply chain for peptide raw materials and finished products. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Industry intermediate

Peptide Supply Chain Management

Management of peptide raw materials, intermediates, and finished products throughout the pharmaceutical supply chain. Covers molecular mechanisms, biological...

Supply Chain intermediate

Peptide surface modification: Comprehensive Peptide Refer...

Comprehensive reference for peptide surface modification, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Sustainability in Manufacturing

Green chemistry and sustainable practices in peptide manufacturing. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Future intermediate

Peptide Theranostics in Nuclear Medicine

Combination of diagnostic imaging and therapeutic radionuclides using same peptide targeting vector for theranostic applications.

Nuclear Medicine advanced

Peptide Theranostics: Oligopeptide Research Reference

Combining diagnostic and therapeutic functions in single peptide-based agents. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Future advanced

Peptide Therapeutic therapeutic-1

Comprehensive reference for peptide therapeutic therapeutic-1, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-10

Comprehensive reference for peptide therapeutic therapeutic-10, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-11

Comprehensive reference for peptide therapeutic therapeutic-11, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-12

Comprehensive reference for peptide therapeutic therapeutic-12, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-13

Comprehensive reference for peptide therapeutic therapeutic-13, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-14

Comprehensive reference for peptide therapeutic therapeutic-14, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-15

Comprehensive reference for peptide therapeutic therapeutic-15, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-16

Comprehensive reference for peptide therapeutic therapeutic-16, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-17

Comprehensive reference for peptide therapeutic therapeutic-17, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-18

Comprehensive reference for peptide therapeutic therapeutic-18, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-19

Comprehensive reference for peptide therapeutic therapeutic-19, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-2

Comprehensive reference for peptide therapeutic therapeutic-2, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-20

Comprehensive reference for peptide therapeutic therapeutic-20, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-21

Comprehensive reference for peptide therapeutic therapeutic-21, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-22

Comprehensive reference for peptide therapeutic therapeutic-22, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-23

Comprehensive reference for peptide therapeutic therapeutic-23, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-24

Comprehensive reference for peptide therapeutic therapeutic-24, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-25

Comprehensive reference for peptide therapeutic therapeutic-25, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-26

Comprehensive reference for peptide therapeutic therapeutic-26, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-27

Comprehensive reference for peptide therapeutic therapeutic-27, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-28

Comprehensive reference for peptide therapeutic therapeutic-28, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-29

Comprehensive reference for peptide therapeutic therapeutic-29, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-3

Comprehensive reference for peptide therapeutic therapeutic-3, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-30

Comprehensive reference for peptide therapeutic therapeutic-30, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-31

Comprehensive reference for peptide therapeutic therapeutic-31, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-32

Comprehensive reference for peptide therapeutic therapeutic-32, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-33

Comprehensive reference for peptide therapeutic therapeutic-33, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-34

Comprehensive reference for peptide therapeutic therapeutic-34, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-35

Comprehensive reference for peptide therapeutic therapeutic-35, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-36

Comprehensive reference for peptide therapeutic therapeutic-36, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-37

Comprehensive reference for peptide therapeutic therapeutic-37, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-38

Comprehensive reference for peptide therapeutic therapeutic-38, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-39

Comprehensive reference for peptide therapeutic therapeutic-39, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-4

Comprehensive reference for peptide therapeutic therapeutic-4, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-40

Comprehensive reference for peptide therapeutic therapeutic-40, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-41

Comprehensive reference for peptide therapeutic therapeutic-41, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-42

Comprehensive reference for peptide therapeutic therapeutic-42, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-43

Comprehensive reference for peptide therapeutic therapeutic-43, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-44

Comprehensive reference for peptide therapeutic therapeutic-44, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-45

Comprehensive reference for peptide therapeutic therapeutic-45, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-46

Comprehensive reference for peptide therapeutic therapeutic-46, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-47

Comprehensive reference for peptide therapeutic therapeutic-47, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-48

Comprehensive reference for peptide therapeutic therapeutic-48, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-49

Comprehensive reference for peptide therapeutic therapeutic-49, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-5

Comprehensive reference for peptide therapeutic therapeutic-5, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-50

Comprehensive reference for peptide therapeutic therapeutic-50, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-6

Comprehensive reference for peptide therapeutic therapeutic-6, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-7

Comprehensive reference for peptide therapeutic therapeutic-7, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-8

Comprehensive reference for peptide therapeutic therapeutic-8, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutic therapeutic-9

Comprehensive reference for peptide therapeutic therapeutic-9, covering molecular structure, pharmacological properties, receptor interactions,

Therapeutic Peptides intermediate

Peptide Therapeutics Article ${i}

peptide therapeutics 201, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 202, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 203, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 204, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 205, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 206, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 207, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 208, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 209, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 210, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 211, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 212, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 213, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 214, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 215, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 216, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 217, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 218, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 219, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 220, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 221, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 222, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 223, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 227, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 226, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 225, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 224, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 229, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 228, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 230, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 232, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 231, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 233, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 235, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 234, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 237, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 236, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 238, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 239, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 240, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 241, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 242, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 243, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 244, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 245, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 247, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 246, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 248, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 249, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 250, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 251, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 252, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 253, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 254, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 255, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 256, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 257, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 258, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 259, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 260, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 261, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 262, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 263, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 265, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 264, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 267, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 266, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 268, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 269, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 270, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 271, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 272, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 273, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 275, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 277, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 276, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 274, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 278, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 279, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 280, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 281, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 282, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 283, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 284, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 285, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 287, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 286, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 289, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 288, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 290, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 291, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 292, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 293, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 294, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 295, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 296, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 297, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 298, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 299, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 300, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 301, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 302, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 303, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 305, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 304, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 306, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 307, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 308, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 309, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 310, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 311, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 312, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 313, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 314, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 315, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 316, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 317, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 318, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 319, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 320, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 321, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 322, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 323, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 324, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 325, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 326, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 327, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 328, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 329, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 330, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 331, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 332, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 333, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 334, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 335, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 337, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 336, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 338, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 339, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 340, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 341, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 342, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 343, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 344, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 346, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 347, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 345, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 348, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 349, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 350, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 352, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 351, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 353, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 354, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 355, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 357, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 356, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 358, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 359, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 360, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 361, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 362, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 363, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 365, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 364, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 366, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 367, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 368, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 369, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 370, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 372, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 371, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 373, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 374, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 375, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 376, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 377, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 378, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 379, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 380, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 382, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 381, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 383, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 384, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 385, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 387, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 386, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 388, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 389, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 390, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 392, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 391, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 393, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 394, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 395, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 396, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 397, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 398, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 399, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 400, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 401, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 402, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 403, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 404, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 405, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 407, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 406, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 408, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 409, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 410, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 411, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 412, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 413, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 414, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 415, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 416, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 417, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 418, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 419, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 421, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 420, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 422, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 423, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 424, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 426, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 425, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 427, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 428, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 429, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 431, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 432, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 430, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 433, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 434, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 436, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 435, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 437, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 438, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 439, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 440, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 441, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 442, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 443, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 444, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 445, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 446, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 447, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 448, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 449, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 451, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 450, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 452, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 453, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 454, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 455, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 457, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 456, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 458, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 459, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 460, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 461, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 462, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 463, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 464, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 465, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 466, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 467, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 468, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 469, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 470, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 471, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 473, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 472, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 475, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 476, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 474, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 477, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 478, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 479, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 480, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 481, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 482, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 483, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 484, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 485, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 486, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 487, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 488, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 489, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 490, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 491, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 492, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 493, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 495, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 494, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 496, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 497, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 498, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 499, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Therapeutics Article ${i}

peptide therapeutics 500, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...

Peptide Therapeutics advanced

Peptide Toxins as Research Tools

Conotoxins and spider venom peptides serve as highly specific ion channel probes and drug discovery leads for neuroscience research and therapeutic development.

Neurology intermediate

Peptide tube assembly: Oligopeptide Research Reference

Comprehensive reference for peptide tube assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Tumor Targeting: Oligopeptide Research Reference

Peptide-based tumor targeting for drug delivery and imaging. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...

Drug Delivery intermediate

Peptide turn assembly: Oligopeptide Research Reference

Comprehensive reference for peptide turn assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide ubiquitination analysis

Comprehensive reference for peptide ubiquitination analysis, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Ubiquitination Sites: Comprehensive Peptide Refer...

Explore ubiquitin conjugation to lysine residues and its role in peptide degradation. This modification affects peptide stability, receptor binding, and biol...

Peptide Modifications advanced

Peptide Urological Therapeutics

Therapeutic peptides for urological conditions including overactive bladder and erectile dysfunction. This peptide or oligopeptide is studied for its biologi...

Therapeutic Peptides intermediate

Peptide Vaccine Delivery: Oligopeptide Research Reference

Peptide-based vaccine delivery systems including adjuvant formulations. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Drug Delivery intermediate

Peptide Vaccine Design: Oligopeptide Research Reference

Principles of peptide-based vaccine development including epitope prediction, adjuvant selection, and nanoparticle delivery strategies for enhanced immunogen...

Immunology intermediate

Peptide Vaccine Immunotherapy: Comprehensive Peptide Refe...

Cancer peptide vaccines using tumor-associated antigen peptides to stimulate anti-tumor immune responses. This peptide or oligopeptide is studied for its bio...

Cancer Immunotherapy intermediate

Peptide Vaccines for Cancer: Comprehensive Peptide Reference

Tumor-associated antigens and neoantigen peptide vaccines combined with checkpoint inhibitors demonstrate promising immunogenicity and clinical responses acr...

Oncology intermediate

Peptide Vaccines: Oligopeptide Research Reference

Learn about peptide-based vaccine design targeting B-cell and T-cell epitopes. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Applications advanced

Peptide vesicle assembly: Oligopeptide Research Reference

Comprehensive reference for peptide vesicle assembly, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide Veterinary Therapeutics

Use of peptide therapeutics in veterinary medicine for companion animals, livestock, and aquaculture. This peptide or oligopeptide is studied for its biologi...

Veterinary Peptides intermediate

Peptide YY Hormone: Endogenous Peptide Hormone Reference

Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Peptide YY Peptide Hormone: Comprehensive Peptide Reference

Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Peptide YY Protein Hormone: Comprehensive Peptide Reference

Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Peptide YY: Endogenous Peptide Hormone Reference

36-amino acid gut hormone released postprandially that suppresses appetite and slows gastric emptying through Y2 receptor signaling.

Gastrointestinal Peptides intermediate

Peptide YY: Neuropeptide in Neuroscience Reference

GI-derived neuropeptide suppressing appetite and slowing gastric emptying. This neuropeptide is involved in neurological signaling and is studied for its rol...

Neuropeptides intermediate

Peptide α-Methylation: Oligopeptide Research Reference

Introduction of methyl group at α-carbon of amino acid residue. Increases metabolic stability, reduces proteolytic degradation, and can modify conformation. ...

Peptide Therapeutics intermediate

Peptide-Aptamer Hybrids: Oligopeptide Research Reference

Chimeric molecules combining peptide and nucleic acid aptamer elements for enhanced target binding and cellular uptake. Covers molecular mechanisms, biologic...

Drug Design advanced

Peptide-Based Biosensors: Oligopeptide Research Reference

A review of peptide-based biosensing platforms including aptamers, molecular imprinted polymers, and lateral flow assays for diagnostic applications.

Biomarker Peptides intermediate

Peptide-Based Contrast Agents: Comprehensive Peptide Refe...

Radiolabeled peptides and MRI contrast agents enable targeted tumor imaging through receptor-mediated accumulation, improving diagnostic sensitivity and trea...

Biomarker Peptides intermediate

Peptide-Based COVID Vaccines: Comprehensive Peptide Refer...

Comprehensive reference for Peptide-Based COVID Vaccines, a peptide compound with applications in research and therapeutics.

Peptide Vaccines intermediate

Peptide-Based Drug Design: Comprehensive Peptide Reference

Resource on computational approaches to peptide drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...

Peptide Therapeutics intermediate

Peptide-Based Hydrogels for Wound Healing

RADA16 self-assembling peptides form hydrogels with antimicrobial activity and hemostatic properties, accelerating tissue repair through biomimetic extracell...

Drug Development intermediate

Peptide-carbohydrate conjugate

Comprehensive reference for peptide-carbohydrate conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide-DM1 Conjugates: Oligopeptide Research Reference

Peptide-DM1 Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

Peptide-Docetaxel Conjugates: Comprehensive Peptide Refer...

Comprehensive reference for Peptide-Docetaxel Conjugates, a peptide compound with applications in research and therapeutics.

Peptide Drug Conjugates intermediate

Peptide-Drug Conjugate Technology

Antibody-peptide conjugate and small molecule-peptide conjugate technologies for targeted drug delivery. This peptide or oligopeptide is studied for its biol...

Drug Conjugates advanced

Peptide-drug conjugate: Oligopeptide Research Reference

Comprehensive reference for peptide-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide-Enzyme: Oligopeptide Research Reference

DPP-4, ACE, Neprilysin, Insulin RTK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Interactions intermediate

Peptide-Exosome Therapeutics: Comprehensive Peptide Refer...

Exosome-based delivery of therapeutic peptides using natural extracellular vesicles as biocompatible carriers. This peptide or oligopeptide is studied for it...

Drug Delivery advanced

Peptide-Ligand: Oligopeptide Research Reference

Biotin-streptavidin, His-NiNTA, GST-GSH, FLAG, HA. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Interactions intermediate

Peptide-lipid conjugate: Oligopeptide Research Reference

Comprehensive reference for peptide-lipid conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide-Loaded Microspheres: Comprehensive Peptide Reference

Learn PLGA microsphere formulations for sustained-release injectable peptide depot delivery. This peptide or oligopeptide is studied for its biological activ...

Drug Delivery intermediate

Peptide-Loaded Nanoparticles: Comprehensive Peptide Refer...

An examination of nanoparticle-based delivery systems for therapeutic peptides, covering PLGA, liposomes, and chitosan carriers with sustained release and ta...

Drug Delivery intermediate

Peptide-MMAE Conjugates: Oligopeptide Research Reference

Peptide-MMAE Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

Peptide-Modified Liposomes: Comprehensive Peptide Reference

Cell-penetrating peptides and RGD-targeted liposomes enhance drug delivery through receptor-mediated uptake and endosomal escape mechanisms for improved intr...

Drug Delivery intermediate

Peptide-Modified Surfaces: Comprehensive Peptide Reference

Biomaterial functionalization with adhesive peptides enhances cell adhesion and biocompatibility, enabling implant coatings that promote tissue integration a...

Peptide Applications intermediate

Peptide-oligonucleotide conjugate

Comprehensive reference for peptide-oligonucleotide conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Peptide-Peptide Interactions: Comprehensive Peptide Refer...

Molecular principles governing peptide association including coiled-coil assembly, leucine zipper formation, and amyloid fibril nucleation and propagation.

Peptide Analysis intermediate

Peptide-Peptide: Oligopeptide Research Reference

Disulfide bonds, amyloid aggregation, collagen, fibrin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Interactions intermediate

Peptide-polymer conjugate: Comprehensive Peptide Reference

Comprehensive reference for peptide-polymer conjugate, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptide-Protein Interaction Design

Computational and experimental approaches to designing peptide-protein interactions. This peptide or oligopeptide is studied for its biological activity, str...

Peptide Future advanced

Peptide-Protein Stapling: Oligopeptide Research Reference

Chemical stapling of peptides to proteins for enhanced stability, cell penetration, and target binding. This peptide or oligopeptide is studied for its biolo...

Drug Design advanced

Peptide-Protein: Oligopeptide Research Reference

Ubiquitin-proteasome, MHC, TCR, BCR. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Interactions intermediate

Peptide-Quantum Dot Conjugates

Bioconjugation of peptides to semiconductor quantum dots for bioimaging, sensing, and targeted delivery applications. Covers molecular mechanisms, biological...

Nanotechnology Peptides advanced

Peptide-Receptor Internalization

Clathrin-mediated endocytosis and caveolae pathways govern peptide-receptor internalization and intracellular trafficking, determining signal termination and...

Peptide Applications intermediate

Peptide-Receptor: Oligopeptide Research Reference

GLP-1R, IR, OXTR, V1aR, V2R, GnRHR, SSTR2, CGRP-R, Y1R, OX1R. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...

Peptide Interactions intermediate

Peptide-SN-38 Conjugates: Oligopeptide Research Reference

Comprehensive reference for Peptide-SN-38 Conjugates, a peptide compound with applications in research and therapeutics.

Peptide Drug Conjugates intermediate

PeptideAtlas: Oligopeptide Research Reference

Database of peptide and protein mass spectrometry data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Peptidomimetic System 1: Oligopeptide Research Reference

A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Peptidomimetic System 2: Oligopeptide Research Reference

A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Peptidomimetic System 3: Oligopeptide Research Reference

A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Peptidomimetic: Oligopeptide Research Reference

Comprehensive reference for peptidomimetic, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Peptidomimetics: Post-Translational Modification Reference

Overview of peptidomimetic compounds designed to overcome peptide drug limitations. This modification affects peptide stability, receptor binding, and biolog...

Peptide Modifications intermediate

Permeation Enhancer Oral: Oligopeptide Research Reference

Chemical permeation enhancers increasing intestinal peptide absorption. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Drug Delivery intermediate

Peroxiredoxin 1: Oligopeptide Research Reference

peroxiredoxin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Antioxidant Peptides intermediate

Persephin Hormone: Endogenous Peptide Hormone Reference

Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Persephin Peptide Hormone: Comprehensive Peptide Reference

Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Persephin Protein Hormone: Comprehensive Peptide Reference

Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

Pexiganan: Antimicrobial Peptide Reference

Synthetic magainin analog antimicrobial peptide for diabetic foot ulcer infections with broad-spectrum activity. Covers molecular mechanisms, biological acti...

Antimicrobial Peptides intermediate

Pfam Resource: Oligopeptide Research Reference

The Pfam database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

PfSPZ: Oligopeptide Research Reference

PfSPZ, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

PG-1 (Porcine): Oligopeptide Research Reference

PG-1 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PG-2 (Porcine): Oligopeptide Research Reference

PG-2 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PG-3 (Porcine): Oligopeptide Research Reference

PG-3 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PG-4 (Porcine): Oligopeptide Research Reference

PG-4 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PG-5 (Porcine): Oligopeptide Research Reference

PG-5 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PGLa: Antimicrobial Peptide Reference

Amphibian antimicrobial peptide from Xenopus laevis that synergizes with magainin 2 for enhanced membrane disruption. Covers molecular mechanisms, biological...

Antimicrobial Peptides intermediate

PGLa: Antimicrobial Peptide Reference

Antimicrobial peptide from Xenopus skin with synergistic activity with magainin. This antimicrobial peptide demonstrates activity against pathogens and is st...

Antimicrobial Peptides intermediate

PH Cleavable Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using PH Cleavable. This analytical technique provides valuable insights into peptide structur...

Purification Methods advanced

Phallacidin: Oligopeptide Research Reference

Phallacidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Phalloidin: Oligopeptide Research Reference

Phalloidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

pharmacodynamic-response Resource

The pharmacodynamic-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

pharmacokinetic-response Resource

The pharmacokinetic-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Pharmacovigilance for Peptides

Learn pharmacovigilance practices for monitoring peptide drug safety including adverse event reporting and signal detection.

Regulatory intermediate

Phaseolin: Oligopeptide Research Reference

Phaseolin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Phenylalanine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Phenylalanine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological...

Amino Acid Metabolism intermediate

Phenylalanine Modification: Comprehensive Peptide Reference

Post-translational modifications of Phenylalanine including phosphorylation, methylation, acetylation, and ubiquitination.

Amino Acid Modifications intermediate

Phenylalanine Peptide: Oligopeptide Research Reference

Phenylalanine (F) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological ...

Amino Acid Peptides beginner

Phenylketonuria (PKU): Oligopeptide Research Reference

Phenylketonuria (PKU), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Metabolic intermediate

Phenylketonuria: Oligopeptide Research Reference

PAH deficiency → elevated phenylalanine. Treatments: diet, pegvaliase, sapropterin. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

Pheromone Biosynthesis Activating Neuropeptide (PBAN)

Comprehensive reference for Pheromone Biosynthesis Activating Neuropeptide (PBAN), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

phi-psi-map Resource: Oligopeptide Research Reference

The phi-psi-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Philanthotoxin (Philanthus): Comprehensive Peptide Reference

Comprehensive reference for Philanthotoxin (Philanthus), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

Philanthotoxin: Peptide Toxin in Pharmacology Reference

Philanthotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Phoratoxin: Oligopeptide Research Reference

Phoratoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Phosphatase Inhibitor PDC: Comprehensive Peptide Reference

A peptide-drug conjugate targeting Phosphatase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, st...

Peptide-Drug Conjugates advanced

Phosphatase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Phosphatase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide-Drug Conjugates advanced

Phospho-tau 181 (p-tau181): Comprehensive Peptide Reference

Comprehensive reference for Phospho-tau 181 (p-tau181), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Phospho-tau 217 (p-tau217): Comprehensive Peptide Reference

Comprehensive reference for Phospho-tau 217 (p-tau217), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Phospho-tau 231 (p-tau231): Comprehensive Peptide Reference

Comprehensive reference for Phospho-tau 231 (p-tau231), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Phosphocarnosine: Oligopeptide Research Reference

phosphocarnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Phosphodiester Bonds in Peptides

Learn about phosphodiester linkages in nucleopeptide conjugates and bioconjugation. This modification affects peptide stability, receptor binding, and biolog...

Peptide Modifications advanced

Phospholipase A2 (Api m 1): Comprehensive Peptide Reference

Comprehensive reference for Phospholipase A2 (Api m 1), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

Phospholipase A2 (Bee): Peptide Toxin in Pharmacology Ref...

Phospholipase A2 (Bee), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Phospholipase A2 SvPLA2: Peptide Toxin in Pharmacology Re...

phospholipase-A2-svPLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its p...

Venom Peptides intermediate

Phospholipase a2: Structure, Function, and Significance

Phospholipase A2 peptides from cobra venom hydrolyze membrane phospholipids, causing cell lysis and inflammation. Covers molecular mechanisms, biological act...

Venom Peptides intermediate

Phosphorodiamidate morpholino: Comprehensive Peptide Refe...

Comprehensive reference for phosphorodiamidate morpholino, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Phosphorothioate RNA: Oligopeptide Research Reference

Comprehensive reference for phosphorothioate rna, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Phosphorylation: Oligopeptide Research Reference

Addition of phosphate group to serine, threonine, or tyrosine. Key regulatory modification. This peptide or oligopeptide is studied for its biological activi...

Peptide Therapeutics intermediate

Photo Cleavable Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Photo Cleavable. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Photochemical Synthesis: Analytical Technique in Peptide ...

A peptide synthesis method using Photochemical for producing peptides with specific properties. This analytical technique provides valuable insights into pep...

Peptide Synthesis Methods advanced

Photochemical Synthesis: Oligopeptide Research Reference

Using light to drive peptide bond formation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

Phrixotoxin 1: Peptide Toxin in Pharmacology Reference

phrixotoxin-1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...

Venom Peptides intermediate

Phrixotoxin 2: Peptide Toxin in Pharmacology Reference

phrixotoxin-2 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...

Venom Peptides intermediate

PhTx3: Peptide Toxin in Pharmacology Reference

PhTx3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Phyllocerulein: Antimicrobial Peptide Reference

Phyllocerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Phyllokinin: Antimicrobial Peptide Reference

Phyllokinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Phylloseptin: Antimicrobial Peptide Reference

Tridecapeptide from Phyllomedusa frog skin with membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathogens and is studi...

Antimicrobial Peptides intermediate

Phytosulfokine: Oligopeptide Research Reference

Phytosulfokine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

pI Resource: Oligopeptide Research Reference

The pI database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...

Databases & Resources intermediate

PI3 Kinase Modulator: Oligopeptide Research Reference

PI3 kinase modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...

Signaling Peptides intermediate

PI3K Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PI3K Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

PI3K Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PI3K Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PI3K Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PI3K Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PI3K Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Pigeon Crop Milk Peptides: Comprehensive Peptide Reference

Comprehensive reference for Pigeon Crop Milk Peptides, a peptide compound with applications in research and therapeutics.

Specialized Peptides intermediate

Pigeon Pituitary Peptide Extract

Comprehensive reference for Pigeon Pituitary Peptide Extract, a peptide compound with applications in research and therapeutics.

Specialized Peptides intermediate

PIK3CA Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PIK3CA Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide-Drug Conjugates advanced

Pine-nut Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pine-nut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

PIONEER 9 Trial: Oligopeptide Research Reference

Clinical trial evaluating iGlarLixi fixed-ratio glargine-lixisenatide versus glargine alone. This peptide or oligopeptide is studied for its biological activ...

Peptide Drugs advanced

Piscidin 1: Oligopeptide Research Reference

Piscidin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Piscidin 2: Oligopeptide Research Reference

Piscidin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Piscidin 3: Oligopeptide Research Reference

Piscidin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Piscidin 4: Oligopeptide Research Reference

Piscidin 4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Piscidin: Structure, Function, and Significance

Piscidins are antimicrobial peptides found in fish mast cells. They have broad-spectrum activity against bacteria, fungi, and parasites.

Antimicrobial Peptides intermediate

Pistachio Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pistachio with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

Pituitary Adenylate Cyclase-Activating Peptide

38-amino acid neuropeptide with neuroprotective, vasodilatory, and immunomodulatory effects through VPAC and PAC1 receptors.

Neuropeptides advanced

Pituitary Extract Peptides (Pigeon)

Comprehensive reference for Pituitary Extract Peptides (Pigeon), a peptide compound with applications in research and therapeutics.

Bird Peptides intermediate

PKA Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKA Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKA Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKA Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKA Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

pKa Resource: Oligopeptide Research Reference

The pKa database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

PKC activation via phorbol ester mimicry

Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

PKC Modulator: Oligopeptide Research Reference

PKC modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

PKC Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKC Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKC Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKC Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

PKC Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Planaria Peptides: Oligopeptide Research Reference

Planaria Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Plant Bioactive Peptides: Oligopeptide Research Reference

Plant Bioactive Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Plant Peptides intermediate

Plant Cyclic Peptides: Oligopeptide Research Reference

Plant Cyclic Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologi...

Plant Peptides intermediate

Plant Defense Peptides: Oligopeptide Research Reference

Plant Defense Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Plant Peptides intermediate

Plant Signaling Peptides: Oligopeptide Research Reference

Plant Signaling Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...

Plant Peptides intermediate

Plant Storage Peptides: Oligopeptide Research Reference

Plant Storage Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...

Plant Peptides intermediate

Plant Toxic Peptides: Oligopeptide Research Reference

Plant Toxic Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Plant Peptides intermediate

Plant: Peptide Toxin in Pharmacology Reference

~0.003 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resea...

Toxin Peptides intermediate

Plantaricin: Antimicrobial Peptide Reference

plantaricin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Plasma Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Plasma for producing peptides with specific properties. This analytical technique provides valuable insights into peptide st...

Peptide Synthesis Methods advanced

Plasmin Inhibitor: Enzyme in Peptide Biology Reference

plasmin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate speci...

Enzyme Peptides intermediate

Plasmodium falciparum: Oligopeptide Research Reference

Binds erythrocyte membrane, remodels host cell. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Protist Peptides intermediate

Platelet Derived Growth Factor AA-1-106

Comprehensive reference for platelet derived growth factor AA-1-106, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Platelet Derived Growth Factor AB

Comprehensive reference for platelet derived growth factor AB, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Platelet Derived Growth Factor BB-1-109

Comprehensive reference for platelet derived growth factor BB-1-109, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Platelet Derived Growth Factor fragment-1-30

Comprehensive reference for platelet derived growth factor fragment-1-30, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Platelet Derived Growth Factor fragment-40-70

Comprehensive reference for platelet derived growth factor fragment-40-70, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Platelet Derived Growth Factor fragment-70-109

Comprehensive reference for platelet derived growth factor fragment-70-109, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Plazomicin: Oligopeptide Research Reference

Plazomicin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Plecanatide - CIC (NCT01996240)

Trial of plecanatide for chronic idiopathic constipation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...

Peptide Therapeutics intermediate

Plecanatide - First-in-Human (NCT01588543)

First-in-human trial of plecanatide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Peptide Therapeutics intermediate

Plecanatide: Oligopeptide Research Reference

Plecanatide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Pleurocidin: Oligopeptide Research Reference

Pleurocidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

PLGA Microsphere System 1: Comprehensive Peptide Reference

A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

PLGA Microsphere System 2: Comprehensive Peptide Reference

A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

PLGA Microsphere System 3: Comprehensive Peptide Reference

A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

PLGA microsphere: Oligopeptide Research Reference

Comprehensive reference for plga microsphere, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

PLGA Nanoparticles Peptide: Comprehensive Peptide Reference

Poly(lactide-co-glycolide) nanoparticles for sustained peptide drug release. This peptide or oligopeptide is studied for its biological activity, structure-a...

Drug Delivery intermediate

Plicamycin (Mithramycin): Oligopeptide Research Reference

Aureolic acid antibiotic from Streptomyces inhibiting RNA synthesis, used for testicular cancer and hypercalcemia. Covers molecular mechanisms, biological ac...

Anticancer Peptides advanced

Plitidepsin T-Cell Lymphoma Agent

Depsipeptide from marine tunicate Aplidium albicans for relapsed/refractory T-cell lymphoma through translation inhibition.

Anticancer Peptides advanced

Plitidepsin: Oligopeptide Research Reference

Marine-derived depsipeptide that inhibits eEF1A, used for multiple myeloma with antiviral activity against SARS-CoV-2. Covers molecular mechanisms, biologica...

Anticancer Peptides advanced

PMAP 23: Antimicrobial Peptide Reference

PMAP-23 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

PMAP 36: Antimicrobial Peptide Reference

PMAP-36 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

PMAP 37: Antimicrobial Peptide Reference

PMAP-37 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

PMDA Peptide Drug Approval: Comprehensive Peptide Reference

Navigate the Japanese Pharmaceuticals and Medical Devices Agency pathway for peptide drug registration. This peptide or oligopeptide is studied for its biolo...

Regulatory advanced

PNA System 1: Oligopeptide Research Reference

A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

PNA System 2: Oligopeptide Research Reference

A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

PNA System 3: Oligopeptide Research Reference

A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...

Drug Delivery Systems advanced

Pneumocandin B0: Oligopeptide Research Reference

Pneumocandin B0, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Pneumonia Peptides: Oligopeptide Research Reference

Peptides associated with Pneumonia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...

Disease-Associated Peptides intermediate

Pneumonia: Oligopeptide Research Reference

Lung infection. Treatments: antibiotics based on pathogen. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Peptide Therapeutics intermediate

PnTx2 6: Peptide Toxin in Pharmacology Reference

pnTx2-6 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...

Venom Peptides intermediate

Point-of-Care Testing: Oligopeptide Research Reference

Peptide-based point-of-care diagnostic tests. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

POL7080: Oligopeptide Research Reference

POL7080, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

polarizability Resource: Oligopeptide Research Reference

The polarizability database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Polatuzumab Vedotin: Oligopeptide Research Reference

Anti-CD79b antibody-drug conjugate with MMAE payload for relapsed or refractory diffuse large B-cell lymphoma. This peptide or oligopeptide is studied for it...

Peptide-Drug Conjugates advanced

Pollinex Quattro: Oligopeptide Research Reference

Pollinex Quattro, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Poly-Arg Peptides: Oligopeptide Research Reference

Poly-Arg Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Polybia-MP1 (Polybia): Oligopeptide Research Reference

Polybia-MP1 (Polybia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Polymer Conjugate System 1: Comprehensive Peptide Reference

A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...

Drug Delivery Systems advanced

Polymer Conjugate System 2: Comprehensive Peptide Reference

A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...

Drug Delivery Systems advanced

Polymer Conjugate System 3: Comprehensive Peptide Reference

A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...

Drug Delivery Systems advanced

Polymer Conjugation Synthesis: Comprehensive Peptide Refe...

A peptide synthesis method using Polymer Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...

Peptide Synthesis Methods advanced

Polymer-Peptide Conjugates: Comprehensive Peptide Reference

Learn PEGylation and polymer conjugation strategies for extending peptide half-life and reducing immunogenicity. Covers molecular mechanisms, biological acti...

Drug Delivery intermediate

Polymerase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Polymerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide-Drug Conjugates advanced

Polymyxin B: Oligopeptide Research Reference

Cyclic lipopeptide antibiotic binding lipopolysaccharide for multidrug-resistant gram-negative infections. This peptide or oligopeptide is studied for its bi...

Peptide Drugs intermediate

Polymyxin B1: Oligopeptide Research Reference

Polymyxin B1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

Polymyxin B2: Antimicrobial Peptide Reference

polymyxin-B2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Polymyxin E: Antimicrobial Peptide Reference

polymyxin-E is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Polymyxin E1: Antimicrobial Peptide Reference

polymyxin-E1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Polymyxin E2: Antimicrobial Peptide Reference

polymyxin-E2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Polymyxin M: Antimicrobial Peptide Reference

polymyxin-M is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Polymyxins: Oligopeptide Research Reference

Antimicrobial (Gram-negative). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Bacterial Peptides intermediate

Polyphemusin: Antimicrobial Peptide Reference

AMP from horseshoe crab with anti-HIV activity through CXCR4 blockade. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...

Antimicrobial Peptides intermediate

Pomegranate Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pomegranate with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-a...

Plant-Derived Peptides intermediate

Pompe Disease: Oligopeptide Research Reference

Acid α-glucosidase deficiency → glycogen accumulation. Treatments: alglucosidase alfa, avalglucosidase alfa. This peptide or oligopeptide is studied for its ...

Peptide Therapeutics intermediate

Ponericin (Pachycondyla): Oligopeptide Research Reference

Comprehensive reference for Ponericin (Pachycondyla), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

Porcine Antimicrobial: Oligopeptide Research Reference

Porcine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologi...

Mammalian Peptides intermediate

Porcine Cathelicidin PMAP-36: Comprehensive Peptide Refer...

Cathelicidin from porcine neutrophils with potent gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and...

Antimicrobial Peptides intermediate

Porcine Defensin PR-39: Antimicrobial Peptide Reference

Proline-arginine-rich antibiotic from porcine neutrophils inhibiting protein synthesis. This antimicrobial peptide demonstrates activity against pathogens an...

Antimicrobial Peptides intermediate

Positional Encoding for Peptides

A computational method for studying peptides using Positional Encoding. This analytical technique provides valuable insights into peptide structure, purity, ...

Computational Methods advanced

Post-Market Surveillance for Peptides

Explore post-marketing surveillance obligations for peptide drugs including safety monitoring and risk management plans.

Regulatory intermediate

Potato Peptide: Oligopeptide Research Reference

A bioactive peptide derived from potato with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Potato Spudin: Oligopeptide Research Reference

potato spudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Food-Derived Peptides intermediate

Potency Testing (Bioassay): Comprehensive Peptide Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Potency Testing: Oligopeptide Research Reference

Potency Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

PP Hormone: Endogenous Peptide Hormone Reference

PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

PP inhibition with homoarginine variant

Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

PP Peptide Hormone: Endogenous Peptide Hormone Reference

PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

PP Protein Hormone: Endogenous Peptide Hormone Reference

PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...

Peptide Hormones intermediate

PP-001: Oligopeptide Research Reference

ADDMADMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

PP-003: Oligopeptide Research Reference

ADDMADMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

PP-005: Oligopeptide Research Reference

MDMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Protist Peptides intermediate

PP-007: Oligopeptide Research Reference

N-hydroxyguanidine organophosphate. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Protist Peptides intermediate

PP-009: Oligopeptide Research Reference

KNYLSLPTQSN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...

Protist Peptides intermediate

PP-011: Oligopeptide Research Reference

NNLNKLKESLHYF. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

PP-013: Oligopeptide Research Reference

YKKLNELQNYLEKH. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

PP-015: Oligopeptide Research Reference

KNGNKNKNKNKGQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

PP-017: Oligopeptide Research Reference

YNKLKHESSYTGY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

PP-019: Oligopeptide Research Reference

GGPLGPGGPLGPG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

PP-021: Oligopeptide Research Reference

QNCLNGSYCPGQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Protist Peptides intermediate

PP-023: Oligopeptide Research Reference

KFLGKLAGKLAG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Protist Peptides intermediate

PP-025: Oligopeptide Research Reference

DSGYDGSGYD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical r...

Protist Peptides intermediate

PP-027: Oligopeptide Research Reference

NDFVNLKNKLIEN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Protist Peptides intermediate

PP-029: Oligopeptide Research Reference

KNGLNGLNNLNN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Protist Peptides intermediate

PP-031: Oligopeptide Research Reference

Zwitterionic guanidinium compound. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Protist Peptides intermediate

PP-033: Oligopeptide Research Reference

Ladder-frame polyether peptide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Protist Peptides intermediate

PP-035: Oligopeptide Research Reference

Large ladder polyether. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Protist Peptides intermediate

PP1/PP2A inhibition via Adda moiety binding

Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

PPV Resource: Oligopeptide Research Reference

The PPV database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...

Databases & Resources intermediate

PR-39: Antimicrobial Peptide Reference

Porcine proline-rich antimicrobial peptide that inhibits bacterial protein synthesis and promotes wound healing through non-lytic mechanisms.

Antimicrobial Peptides intermediate

PR-39: Oligopeptide Research Reference

PR-39, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Pramlintide: Oligopeptide Research Reference

pramlintide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Pramlintide: Oligopeptide Research Reference

Synthetic amylin analog that slows gastric emptying and suppresses glucagon for improved glycemic control in diabetes. Covers molecular mechanisms, biologica...

Diabetes Peptides intermediate

Pramlintide: Oligopeptide Research Reference

Pramlintide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides intermediate

Precipitation Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Precipitation. This analytical technique provides valuable insights into peptide structu...

Purification Methods advanced

Precipitation: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

precision Resource: Oligopeptide Research Reference

The precision database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Pregnancy: Oligopeptide Research Reference

Safety considerations for peptide drugs during pregnancy and lactation. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Premixed Insulin 50/50: Peptide Family Reference

Equal-ratio premixed insulin containing 50% intermediate-acting protamine lispro and 50% rapid-acting insulin lispro. Covers molecular mechanisms, biological...

Insulin Family beginner

Premixed Insulin 70/30: Oligopeptide Research Reference

Fixed combination of 70% NPH intermediate-acting and 30% regular insulin for twice-daily basal-bolus coverage. This peptide or oligopeptide is studied for it...

Peptide Drugs beginner

Premixed Insulin 75/25: Peptide Family Reference

Fixed-ratio premixed insulin containing 75% intermediate-acting protamine lispro and 25% rapid-acting insulin lispro. Covers molecular mechanisms, biological...

Insulin Family beginner

Preparative Chromatography: Comprehensive Peptide Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

prevalence Resource: Oligopeptide Research Reference

The prevalence database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ac...

Databases & Resources intermediate

PRIDE: Oligopeptide Research Reference

Proteomics Identifications Database for mass spectrometry data. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Peptide Therapeutics intermediate

primary-endpoint Resource: Comprehensive Peptide Reference

The primary-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Principal Component for Peptides

A computational method for studying peptides using Principal Component. This analytical technique provides valuable insights into peptide structure, purity, ...

Computational Methods advanced

Prion Diseases: Oligopeptide Research Reference

Transmissible spongiform encephalopathies caused by PrPSc. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...

Peptide Therapeutics intermediate

Prion Protein (PrP): Oligopeptide Research Reference

Prion Protein (PrP), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarker Peptides intermediate

Prion Protein (PrPSc): Oligopeptide Research Reference

Misfolded prion protein. Transmissible spongiform encephalopathies. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Prion protein folding: Oligopeptide Research Reference

Comprehensive reference for prion protein folding, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Prion Protein Misfolding (Conformational Change)

Comprehensive reference for Prion Protein Misfolding (Conformational Change), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Procalcitonin (PCT): Oligopeptide Research Reference

Procalcitonin (PCT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarker Peptides intermediate

Processed through secretory pathway by Kex2p and Ste13p

Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

Progesterone Hormone: Endogenous Peptide Hormone Reference

Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Progesterone Peptide Hormone: Comprehensive Peptide Refer...

Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Progesterone Protein Hormone: Comprehensive Peptide Refer...

Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

progression-free-survival Resource

The progression-free-survival database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

progressive-disease Resource: Comprehensive Peptide Refer...

The progressive-disease database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Proinsulin: Oligopeptide Research Reference

Single-chain precursor of insulin containing A chain, B chain, and connecting C-peptide, cleaved to release mature insulin.

Pancreatic Peptides intermediate

Prolactin Family Peptides: Comprehensive Peptide Reference

Learn about prolactin family peptides and their roles in lactation, reproduction, and immune modulation. This peptide or oligopeptide is studied for its biol...

Peptide Families intermediate

Prolactin-Releasing Peptide: Comprehensive Peptide Reference

Hypothalamic peptide stimulating prolactin release from anterior pituitary. This neuropeptide is involved in neurological signaling and is studied for its ro...

Neuropeptides intermediate

Prolactin-Releasing Peptide: Comprehensive Peptide Reference

Prolactin-releasing peptide is a hypothalamic neuropeptide that stimulates prolactin secretion through GPR10 receptor activation in the anterior pituitary.

Neuropeptides intermediate

Proline Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Proline including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...

Amino Acid Metabolism intermediate

Proline Modification: Post-Translational Modification Ref...

Post-translational modifications of Proline including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...

Amino Acid Modifications intermediate

Proline Peptide: Oligopeptide Research Reference

Proline (P) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...

Amino Acid Peptides beginner

Prolyl hydroxyproline: Structure, Function, and Significance

Prolyl-hydroxyproline (Pro-Hyp) is a bioactive dipeptide from collagen digestion that stimulates fibroblast proliferation and hyaluronic acid synthesis.

Structural Peptides intermediate

Prophenin: Oligopeptide Research Reference

Prophenin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

PROSITE Resource: Oligopeptide Research Reference

The PROSITE database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...

Databases & Resources intermediate

Prostate Cancer Peptides: Oligopeptide Research Reference

Peptides associated with Prostate Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...

Disease-Associated Peptides intermediate

Prostate Cancer: Oligopeptide Research Reference

Malignant transformation of prostate epithelial cells. Most common cancer in men. Androgen-dependent in most cases. PSA screening: controversial (overdiagnos...

Peptide Therapeutics intermediate

PROTAC degradation: Oligopeptide Research Reference

Comprehensive reference for protac degradation, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

PROTAC System 1: Oligopeptide Research Reference

A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

PROTAC System 2: Oligopeptide Research Reference

A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

PROTAC System 3: Oligopeptide Research Reference

A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...

Drug Delivery Systems advanced

Protease Inhibitor Delivery: Comprehensive Peptide Reference

Co-administered protease inhibitors protecting peptides from GI enzymatic degradation. This peptide or oligopeptide is studied for its biological activity, s...

Drug Delivery intermediate

Protease Inhibitor Interactions

Drug interactions between protease inhibitor peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Therapeutics intermediate

Protease Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Protease Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide-Drug Conjugates advanced

Protease PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Protease for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide-Drug Conjugates advanced

Proteasome Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Proteasome Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, str...

Peptide-Drug Conjugates advanced

Proteasome PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Proteasome for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide-Drug Conjugates advanced

Protectin D1: Oligopeptide Research Reference

protectin D1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Anti-inflammatory Peptides intermediate

Protegrin 1: Antimicrobial Peptide Reference

Porcine antimicrobial peptide with beta-hairpin structure that rapidly kills multidrug-resistant bacteria through membrane disruption.

Antimicrobial Peptides intermediate

Protegrin 1: Oligopeptide Research Reference

Protegrin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Protegrin 2: Oligopeptide Research Reference

Protegrin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Protegrin 3: Oligopeptide Research Reference

Protegrin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Protein A Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using Protein A. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

Protein Conjugation Synthesis: Comprehensive Peptide Refe...

A peptide synthesis method using Protein Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...

Peptide Synthesis Methods advanced

Protein G Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using Protein G. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

Protein L Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using Protein L. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

Protein phosphatase inhibition

Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Protist Peptides intermediate

Protein Purification / Biochemistry

Protein Purification / Biochemistry is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Peptide Interactions intermediate

Protein Science: Oligopeptide Research Reference

Journal dedicated to protein structure, function, and engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity re...

Peptide Therapeutics intermediate

Protein Society: Oligopeptide Research Reference

Professional society for protein science research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Therapeutics intermediate

ProteinMPNN for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using ProteinMPNN. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

Prothoracicotropic Hormone (PTTH)

Comprehensive reference for Prothoracicotropic Hormone (PTTH), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

proton-affinity Resource: Oligopeptide Research Reference

The proton-affinity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...

Databases & Resources intermediate

ProTx-II: Peptide Toxin in Pharmacology Reference

ProTx-II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

PS3: Oligopeptide Research Reference

Automated peptide synthesizer for SPPS with multiple reaction vessel capability. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

PSA: Oligopeptide Research Reference

240-aa kallikrein-related peptidase (hK3) secreted by prostate epithelial cells. Cleaves semenogelin. Normal: <4 ng/mL (age-adjusted). Elevated in prostate c...

Peptide Therapeutics intermediate

Psalmotoxin 1: Peptide Toxin in Pharmacology Reference

Psalmotoxin-1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...

Venom Peptides intermediate

Psi-Conotoxin TxVII: Peptide Toxin in Pharmacology Reference

Calcium channel modulator from Conus textile with unique disulfide connectivity. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

PSK: Oligopeptide Research Reference

PSK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Psoriasis Peptides: Oligopeptide Research Reference

Peptides associated with Psoriasis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...

Disease-Associated Peptides intermediate

PTEN Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting PTEN Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

PTH (Parathyroid Hormone): Comprehensive Peptide Reference

Comprehensive reference for PTH (Parathyroid Hormone), a peptide compound with applications in research and therapeutics.

Biomarker Peptides intermediate

PTH 1-34: Peptide Fragment Reference

Comprehensive reference for PTH 1-34 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-38: Peptide Fragment Reference

Comprehensive reference for PTH 1-38 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-41: Peptide Fragment Reference

Comprehensive reference for PTH 1-41 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-44: Peptide Fragment Reference

Comprehensive reference for PTH 1-44 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-47: Peptide Fragment Reference

Comprehensive reference for PTH 1-47 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-50: Peptide Fragment Reference

Comprehensive reference for PTH 1-50 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-53: Peptide Fragment Reference

Comprehensive reference for PTH 1-53 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-56: Peptide Fragment Reference

Comprehensive reference for PTH 1-56 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-59: Peptide Fragment Reference

Comprehensive reference for PTH 1-59 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-62: Peptide Fragment Reference

Comprehensive reference for PTH 1-62 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-65: Peptide Fragment Reference

Comprehensive reference for PTH 1-65 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-68: Peptide Fragment Reference

Comprehensive reference for PTH 1-68 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-71: Peptide Fragment Reference

Comprehensive reference for PTH 1-71 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-74: Peptide Fragment Reference

Comprehensive reference for PTH 1-74 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-77: Peptide Fragment Reference

Comprehensive reference for PTH 1-77 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-80: Peptide Fragment Reference

Comprehensive reference for PTH 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-83: Peptide Fragment Reference

Comprehensive reference for PTH 1-83 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 1-84 Hypoparathyroidism: Comprehensive Peptide Reference

Full-length parathyroid hormone for hypoparathyroidism replacement providing calcium homeostasis. This peptide or oligopeptide is studied for its biological ...

Peptide Drugs intermediate

PTH 1-84: Peptide Fragment Reference

Comprehensive reference for PTH 1-84 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 14-34: Peptide Fragment Reference

Comprehensive reference for PTH 14-34 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 3-34: Peptide Fragment Reference

Comprehensive reference for PTH 3-34 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH 7-34: Peptide Fragment Reference

Comprehensive reference for PTH 7-34 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

PTH Hormone: Endogenous Peptide Hormone Reference

PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

PTH Peptide Hormone: Endogenous Peptide Hormone Reference

PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

PTH Protein Hormone: Endogenous Peptide Hormone Reference

PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

PubChem: Oligopeptide Research Reference

Chemical compound database with structures, properties, and bioactivity. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Therapeutics intermediate

PubMedBERT for Peptides: Analytical Technique in Peptide ...

A computational method for studying peptides using PubMedBERT. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Computational Methods advanced

Pufferfish: Peptide Toxin in Pharmacology Reference

0.008 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...

Toxin Peptides intermediate

Pulchrinin: Peptide Toxin in Pharmacology Reference

pulchrinin is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for its p...

Venom Peptides intermediate

Pulmonary delivery: Oligopeptide Research Reference

Comprehensive reference for pulmonary delivery, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Pulmonary Embolism: Oligopeptide Research Reference

Blood clot in pulmonary arteries. Usually from DVT. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Peptide Therapeutics intermediate

Pulmonary Fibrosis Peptides: Comprehensive Peptide Reference

Peptides associated with Pulmonary Fibrosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...

Disease-Associated Peptides intermediate

Pulmonary Peptide Delivery: Comprehensive Peptide Reference

Inhaled peptide formulations for lung delivery targeting respiratory or systemic effects. This peptide or oligopeptide is studied for its biological activity...

Drug Delivery intermediate

Pulmonary System 1: Oligopeptide Research Reference

A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Pulmonary System 2: Oligopeptide Research Reference

A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Pulmonary System 3: Oligopeptide Research Reference

A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Pumpkin Peptide: Oligopeptide Research Reference

A bioactive peptide derived from pumpkin with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

PUR-011: Oligopeptide Research Reference

High resolution, polishing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Peptide Manufacturing intermediate

PUR-012: Oligopeptide Research Reference

Charge-based, scalable. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Peptide Manufacturing intermediate

PUR-013: Oligopeptide Research Reference

Aggregate removal, desalting. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Manufacturing intermediate

PUR-014: Oligopeptide Research Reference

Highly selective, one-step. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Peptide Manufacturing intermediate

PUR-015: Oligopeptide Research Reference

Scalable, buffer exchange. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Peptide Manufacturing intermediate

PUR-016: Oligopeptide Research Reference

Solid form, high purity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Peptide Manufacturing intermediate

PUR-017: Oligopeptide Research Reference

Cost-effective, capture. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Peptide Manufacturing intermediate

PUR-018: Oligopeptide Research Reference

Hydrophobic impurity removal. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Manufacturing intermediate

PUR-019: Oligopeptide Research Reference

Industrial scale. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Peptide Manufacturing intermediate

PUR-020: Oligopeptide Research Reference

High resolution analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Manufacturing intermediate

Purification (10 processes): Comprehensive Peptide Reference

Comprehensive reference for Purification (10 processes), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Purity Testing (HPLC Analysis)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Purity Testing: Oligopeptide Research Reference

Purity Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

PyMOL: Oligopeptide Research Reference

Molecular visualization system for 3D structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Therapeutics intermediate

PYY (3-36): Neuropeptide in Neuroscience Reference

PYY (3-36), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

PYY → DPP-4 (Substrate): Oligopeptide Research Reference

PYY → DPP-4 (Substrate), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

PYY Hormone: Endogenous Peptide Hormone Reference

PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

PYY Peptide Hormone: Endogenous Peptide Hormone Reference

PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

PYY Protein Hormone: Endogenous Peptide Hormone Reference

PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

QC-031: Oligopeptide Research Reference

Purity %. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...

Peptide Manufacturing intermediate

QC-032: Oligopeptide Research Reference

Molecular weight, sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...

Peptide Manufacturing intermediate

QC-033: Oligopeptide Research Reference

Biological activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Peptide Manufacturing intermediate

QC-034: Oligopeptide Research Reference

Shelf life. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical r...

Peptide Manufacturing intermediate

QC-035: Oligopeptide Research Reference

Microbial limits. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Peptide Manufacturing intermediate

QSAR for Peptides: Analytical Technique in Peptide Research

Discover quantitative structure-activity relationship modeling for predicting peptide biological activity from structure.

Peptide Analysis advanced

QSAR: Oligopeptide Research Reference

Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...

Peptide Technologies intermediate

quadrupole-moment Resource: Comprehensive Peptide Reference

The quadrupole-moment database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Quality by Design: Oligopeptide Research Reference

Quality by Design approach to peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Quality Control (5 processes): Comprehensive Peptide Refe...

Comprehensive reference for Quality Control (5 processes), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Quality Specifications: Oligopeptide Research Reference

Quality Specifications, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarkers Expanded intermediate

quality-of-life Resource: Oligopeptide Research Reference

The quality-of-life database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...

Databases & Resources intermediate

Quantum Dot Labeling Synthesis

A peptide synthesis method using Quantum Dot Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Quantum Mechanics for Peptides

A computational method for studying peptides using Quantum Mechanics. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

Quasi Harmonic for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Quasi Harmonic. This analytical technique provides valuable insights into peptide structure, purity, and c...

Computational Methods advanced

Quaternary Interface 1: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 10: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 11: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 12: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 13: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 14: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 15: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 16: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 17: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 18: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 19: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 2: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 20: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 21: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 22: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 23: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 24: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 25: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 26: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 27: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 28: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 29: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 3: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 30: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 31: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 32: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 33: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 34: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 35: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 36: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 37: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 38: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 39: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 4: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 40: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 41: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 42: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 43: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 44: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 45: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 46: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 47: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 48: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 49: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 5: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 50: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 6: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 7: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 8: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quaternary Interface 9: Oligopeptide Research Reference

A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...

Quaternary Structure Peptides advanced

Quercetin Peptide: Oligopeptide Research Reference

quercetin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Antioxidant Peptides intermediate

Quinoa Peptide: Oligopeptide Research Reference

A bioactive peptide derived from quinoa with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

R21/Matrix-M: Oligopeptide Research Reference

R21/Matrix-M, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

R8 (Octa-Arginine): Oligopeptide Research Reference

R8 (Octa-Arginine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Rabbit Cathelicidin CAP-18: Comprehensive Peptide Reference

Cathelicidin from rabbit neutrophils generating LL-37-equivalent active fragment. This antimicrobial peptide demonstrates activity against pathogens and is s...

Antimicrobial Peptides intermediate

Rabbit Defensin NP-1: Antimicrobial Peptide Reference

Neutrophil defensin from rabbit with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is studied ...

Antimicrobial Peptides intermediate

Rabies G Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Rabies G for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Rabies Peptides: Oligopeptide Research Reference

Peptides associated with Rabies including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Radioactive Labeling Synthesis

A peptide synthesis method using Radioactive Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Radiolabeled / Diagnostic: Comprehensive Peptide Reference

Radiolabeled / Diagnostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...

Peptide Drug Conjugates intermediate

Radiolabeled / Theranostic: Comprehensive Peptide Reference

Radiolabeled / Theranostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...

Peptide Drug Conjugates intermediate

RAF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting RAF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

RAF Inhibitor: Oligopeptide Research Reference

RAF inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

RALF: Oligopeptide Research Reference

RALF, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

ramachandran Resource: Oligopeptide Research Reference

The ramachandran database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ...

Databases & Resources intermediate

Raman Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using Raman. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

Raman Spectroscopy for Peptides

Explore Raman spectroscopy for label-free peptide structural characterization and conformational analysis. This peptide or oligopeptide is studied for its bi...

Peptide Analysis advanced

Ramipril: Oligopeptide Research Reference

Ramipril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Ranacyclin: Antimicrobial Peptide Reference

Cyclic AMP from Rana species with disulfide-stabilized structure. This antimicrobial peptide demonstrates activity against pathogens and is studied for its m...

Antimicrobial Peptides intermediate

Ranatensin: Antimicrobial Peptide Reference

Ranatensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Ranatuerin 2CSa: Antimicrobial Peptide Reference

ranatuerin-2CSa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its b...

Antimicrobial Peptides intermediate

Ranatuerin 2CSb: Antimicrobial Peptide Reference

ranatuerin-2CSb is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its b...

Antimicrobial Peptides intermediate

Ranatuerin-2: Antimicrobial Peptide Reference

Ranatuerin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Ranatuerin: Structure, Function, and Significance

Ranatuerins are antimicrobial peptides from frog skin with unique structural features that enhance membrane selectivity.

Antimicrobial Peptides intermediate

Random Coil System 1: Oligopeptide Research Reference

A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Random Coil System 2: Oligopeptide Research Reference

A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Random Coil System 3: Oligopeptide Research Reference

A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Rare Disease / Enzyme Replacement Therapy

Rare Disease / Enzyme Replacement Therapy is a bioactive compound with applications in peptide research and therapeutics.

Therapeutic Peptides Expanded intermediate

Rare Diseases and Peptides: Comprehensive Peptide Reference

Explore orphan peptide drugs for rare diseases including enzyme replacement therapies and receptor-targeting peptides. Covers molecular mechanisms, biologica...

Peptide Therapeutics advanced

Rare Diseases: Oligopeptide Research Reference

Peptide therapeutics for rare diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

RAS Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting RAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

RAS Inhibitor: Oligopeptide Research Reference

RAS inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

Ras-Raf-MEK-ERK Pathway Peptide 1

A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Ras-Raf-MEK-ERK Pathway Peptide 2

A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Ras-Raf-MEK-ERK Pathway Peptide 3

A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Ras-Raf-MEK-ERK Pathway Peptide 4

A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Ras-Raf-MEK-ERK Pathway Peptide 5

A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Raspberry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from raspberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

RB1 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting RB1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Real-time quaking-induced conversion

Prion disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Biomarkers Expanded intermediate

Real-World Evidence: Oligopeptide Research Reference

Real-World Evidence, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Regulatory intermediate

Rebaudioside A: Oligopeptide Research Reference

rebaudioside A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...

Agricultural Peptides intermediate

recall Resource: Oligopeptide Research Reference

The recall database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...

Databases & Resources intermediate

Recently Expired Patents: Oligopeptide Research Reference

Comprehensive reference for Recently Expired Patents, a peptide compound with applications in research and therapeutics.

Peptide Patents intermediate

Receptor binding on cell wall glucan

Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

Receptor tyrosine kinase: Oligopeptide Research Reference

Comprehensive reference for receptor tyrosine kinase, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Recombinant Actin: Oligopeptide Research Reference

recombinant actin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Structural Peptides intermediate

Recombinant Collagen I: Oligopeptide Research Reference

recombinant collagen I in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Structural Peptides intermediate

Recombinant Collagen III: Oligopeptide Research Reference

recombinant collagen III in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Structural Peptides intermediate

Recombinant DNA technology, E. coli expression systems

Recombinant DNA technology, E. coli expression systems is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Recombinant Elastin: Oligopeptide Research Reference

recombinant elastin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Structural Peptides intermediate

Recombinant Expression: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Recombinant GFAP: Oligopeptide Research Reference

recombinant GFAP in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Structural Peptides intermediate

Recombinant Keratin: Oligopeptide Research Reference

recombinant keratin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Structural Peptides intermediate

Recombinant Lamin: Oligopeptide Research Reference

recombinant lamin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...

Structural Peptides intermediate

Recombinant Nestin: Oligopeptide Research Reference

recombinant nestin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Structural Peptides intermediate

Recombinant Resilin: Oligopeptide Research Reference

recombinant resilin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Structural Peptides intermediate

Recombinant Silk Fibroin: Oligopeptide Research Reference

recombinant silk fibroin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Structural Peptides intermediate

Recombinant Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using Recombinant for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

Recombinant Tubulin: Oligopeptide Research Reference

recombinant tubulin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Structural Peptides intermediate

recommended-phase2-dose Resource

The recommended-phase2-dose database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Rectal Peptide Delivery: Oligopeptide Research Reference

Rectal delivery systems for peptide drugs avoiding first-pass metabolism. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Drug Delivery intermediate

Red Blood Cell Peptide Delivery

Explore erythrocyte-based carriers for extending peptide circulation time through cellular encapsulation. This peptide or oligopeptide is studied for its bio...

Drug Delivery advanced

Reduced affinity Ste2p binding

Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

Reduction Cleavable Purification

A purification technique for separating and isolating peptides using Reduction Cleavable. This analytical technique provides valuable insights into peptide s...

Purification Methods advanced

RefSeq: Oligopeptide Research Reference

Reference sequence database for genomes, transcripts, and proteins. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Peptide Therapeutics intermediate

Regulatory Harmonization: Oligopeptide Research Reference

Comprehensive reference for Regulatory Harmonization, a peptide compound with applications in research and therapeutics.

Regulatory intermediate

Regulatory Science for Peptide Drugs

Emerging regulatory science concepts for evaluating peptide drug products. This peptide or oligopeptide is studied for its biological activity, structure-act...

Regulatory Affairs advanced

Relaxin Family Peptides: Oligopeptide Research Reference

Explore relaxin, insulin-like peptides, and their roles in reproduction and tissue remodeling. This peptide or oligopeptide is studied for its biological act...

Peptide Families intermediate

Relugolix: Oligopeptide Research Reference

Oral GnRH receptor antagonist for prostate cancer and uterine fibroids with rapid suppression. This peptide or oligopeptide is studied for its biological act...

Peptide Drugs intermediate

Remifentanil Ultra-Short: Neuropeptide in Neuroscience Re...

Ultra-short-acting opioid with esterase metabolism for surgical anesthesia. This neuropeptide is involved in neurological signaling and is studied for its ro...

Neuropeptides intermediate

Remifentanil: Oligopeptide Research Reference

Remifentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Renal Impairment: Oligopeptide Research Reference

Considerations for peptide drug dosing in patients with kidney disease. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Renin Hormone: Endogenous Peptide Hormone Reference

Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

Renin Inhibitor: Enzyme in Peptide Biology Reference

renin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifi...

Enzyme Peptides intermediate

Renin Peptide Hormone: Endogenous Peptide Hormone Reference

Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

Renin Protein Hormone: Endogenous Peptide Hormone Reference

Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...

Peptide Hormones intermediate

Renin Substrate: Oligopeptide Research Reference

renin substrate in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Cardiovascular Peptides intermediate

Renin: Enzyme in Peptide Biology Reference

Aspartyl protease enzyme that cleaves angiotensinogen to angiotensin I, initiating the renin-angiotensin-aldosterone system.

Cardiovascular Peptides intermediate

Replica Exchange for Peptides: Comprehensive Peptide Refe...

A computational method for studying peptides using Replica Exchange. This analytical technique provides valuable insights into peptide structure, purity, and...

Computational Methods advanced

Reproductive / GnRH Antagonist

Reproductive / GnRH Antagonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...

Therapeutic Peptides intermediate

Reproductive Endocrinology: Comprehensive Peptide Reference

Reproductive Endocrinology is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...

Peptide Interactions intermediate

Reproductive Neuropeptides: Comprehensive Peptide Reference

Hypothalamic peptides controlling gonadotropin release and reproductive function. This neuropeptide is involved in neurological signaling and is studied for ...

Neuropeptides intermediate

Research Synthetic: Oligopeptide Research Reference

Cell-penetrating and research peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Synthetic Peptides intermediate

Resistin Hormone: Endogenous Peptide Hormone Reference

Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Resistin Peptide Hormone: Endogenous Peptide Hormone Refe...

Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Resistin Protein Hormone: Endogenous Peptide Hormone Refe...

Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Resistin: Oligopeptide Research Reference

Resistin is an adipokine that links obesity to insulin resistance and inflammation through AdipoR1 and TLR4 receptor-mediated signaling pathways.

Metabolic intermediate

Resolvin D1: Oligopeptide Research Reference

resolvin D1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Anti-inflammatory Peptides intermediate

Resolvin E1: Oligopeptide Research Reference

resolvin E1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Anti-inflammatory Peptides intermediate

ResPep: Oligopeptide Research Reference

Peptide synthesizer for research-scale SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

response-rate Resource: Oligopeptide Research Reference

The response-rate database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...

Databases & Resources intermediate

Resveratrol Peptide: Oligopeptide Research Reference

resveratrol peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Antioxidant Peptides intermediate

RET Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting RET Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Retatrutide: Oligopeptide Research Reference

Triple agonist targeting GLP-1, GIP, and glucagon receptors showing unprecedented weight loss in trials. This peptide or oligopeptide is studied for its biol...

Peptide Drugs advanced

Reverse Phase HPLC (RP-HPLC): Comprehensive Peptide Refer...

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Reversed Phase Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Reversed Phase. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

RFdiffusion for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using RFdiffusion. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

RFdiffusion: Oligopeptide Research Reference

High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

Rheumatoid Peptides: Oligopeptide Research Reference

Peptides associated with Rheumatoid including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Rho-GTPase Pathway Peptide 1: Comprehensive Peptide Refer...

A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Rho-GTPase Pathway Peptide 2: Comprehensive Peptide Refer...

A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Rho-GTPase Pathway Peptide 3: Comprehensive Peptide Refer...

A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Rho-GTPase Pathway Peptide 4: Comprehensive Peptide Refer...

A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Rho-GTPase Pathway Peptide 5: Comprehensive Peptide Refer...

A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

RIA Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using RIA. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

Riboswitch: Oligopeptide Research Reference

Comprehensive reference for riboswitch, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Ribozyme: Oligopeptide Research Reference

Comprehensive reference for ribozyme, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Rice Oryzatin: Oligopeptide Research Reference

rice oryzatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Food-Derived Peptides intermediate

Rice Peptide: Oligopeptide Research Reference

A bioactive peptide derived from rice with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Plant-Derived Peptides intermediate

Ricin: Peptide Toxin in Pharmacology Reference

Ricin is a highly toxic heterodimeric ribosome-inactivating protein from castor beans (Ricinus communis) that inhibits protein synthesis through N-glycosidas...

Toxin Peptides advanced

Rift Valley N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Rift Valley N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Vaccines advanced

rigidity Resource: Oligopeptide Research Reference

The rigidity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Rilonacept: Oligopeptide Research Reference

rilonacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Rimegepant - First-in-Human (NCT01434008)

First-in-human trial of rimegepant for migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

Rimegepant - Migraine (NCT03235479)

Phase III trial of rimegepant for acute migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Therapeutics intermediate

Rimegepant: Oligopeptide Research Reference

Oral CGRP receptor antagonist for both acute migraine treatment and prevention. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide Drugs beginner

Rimorphin: Neuropeptide in Neuroscience Reference

rimorphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.

Neuropeptides intermediate

Ring Closing Metathesis Synthesis

A peptide synthesis method using Ring Closing Metathesis for producing peptides with specific properties. This peptide or oligopeptide is studied for its bio...

Peptide Synthesis Methods advanced

Risankizumab: Oligopeptide Research Reference

risankizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Risdiplam: Oligopeptide Research Reference

Risdiplam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Rituximab: Oligopeptide Research Reference

rituximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

RM-1-MMAE: Oligopeptide Research Reference

RM-1-MMAE, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

RMSD Resource: Oligopeptide Research Reference

The RMSD database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

RNA Conjugation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using RNA Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

RNA interference: Oligopeptide Research Reference

Comprehensive reference for rna interference, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

RoBERTa for Peptides: Analytical Technique in Peptide Res...

A computational method for studying peptides using RoBERTa. This analytical technique provides valuable insights into peptide structure, purity, and characte...

Computational Methods advanced

Romidepsin HDAC Inhibitor: Comprehensive Peptide Reference

Cyclic depsipeptide histone deacetylase inhibitor for cutaneous T-cell lymphoma derived from Chromobacterium violaceum. Covers molecular mechanisms, biologic...

Anticancer Peptides advanced

Romidepsin: Oligopeptide Research Reference

Bicyclic depsipeptide histone deacetylase inhibitor from Chromobacterium violaceum used for T-cell lymphoma treatment. Covers molecular mechanisms, biologica...

Anticancer Peptides advanced

Romiplostim - ITP (NCT00000129)

Trial of romiplostim for immune thrombocytopenia. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Therapeutics intermediate

Romiplostim: Oligopeptide Research Reference

Thrombopoietin receptor agonist peptibody for immune thrombocytopenia, stimulating platelet production through TPO receptor activation.

Hematopoietic Peptides advanced

Romosozumab: Oligopeptide Research Reference

Anti-sclerostin monoclonal antibody for osteoporosis stimulating formation and reducing resorption. This peptide or oligopeptide is studied for its biologica...

Peptide Drugs intermediate

ROS1 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting ROS1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

RoseTTAFold for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using RoseTTAFold. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

RoseTTAFold: Oligopeptide Research Reference

High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...

Peptide Technologies intermediate

rotamer Resource: Oligopeptide Research Reference

The rotamer database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...

Databases & Resources intermediate

Royalisin (Apis): Oligopeptide Research Reference

Royalisin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

RP HPLC Purification: Analytical Technique in Peptide Res...

A purification technique for separating and isolating peptides using RP HPLC. This analytical technique provides valuable insights into peptide structure, pu...

Purification Methods advanced

RP-HPLC (Reverse Phase High Performance Liquid Chromatogr...

Comprehensive reference for RP-HPLC (Reverse Phase High Performance Liquid Chromatogr..., a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

RSV F Protein: Oligopeptide Research Reference

RSV-F-protein is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...

Peptide Vaccines intermediate

RSV F Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting RSV F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Peptide Vaccines advanced

RTL1000: Oligopeptide Research Reference

RTL1000, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

RTS,S/AS01 (Mosquirix): Oligopeptide Research Reference

RTS,S/AS01 (Mosquirix), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

Rubiscolin 5: Oligopeptide Research Reference

rubiscolin-5 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Rubiscolin 6: Oligopeptide Research Reference

rubiscolin-6 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Rubiscolin: Oligopeptide Research Reference

Leu-enkephalin analog (Tyr-Gly-Gly-Phe-Leu) derived from spinach RuBisCO enzyme. Has opioid activity at delta-opioid receptors. Found in spinach and other le...

Peptide Therapeutics intermediate

Rye Peptide: Oligopeptide Research Reference

A bioactive peptide derived from rye with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Plant-Derived Peptides intermediate

S Agalactiae Peptide: Oligopeptide Research Reference

A peptide associated with S Agalactiae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...

Microbial Peptides intermediate

S Aureus Mrsa Peptide: Oligopeptide Research Reference

A peptide associated with S Aureus Mrsa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

S Aureus Peptide: Oligopeptide Research Reference

A peptide associated with S Aureus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

S Aureus Vrsa Peptide: Oligopeptide Research Reference

A peptide associated with S Aureus Vrsa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

S Enteritidis Peptide: Oligopeptide Research Reference

A peptide associated with S Enteritidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

S Epidermidis Peptide: Oligopeptide Research Reference

A peptide associated with S Epidermidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

S Flexneri Peptide: Oligopeptide Research Reference

A peptide associated with S Flexneri for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...

Microbial Peptides intermediate

S Mutans Peptide: Oligopeptide Research Reference

A peptide associated with S Mutans for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

S Pneumoniae Peptide: Oligopeptide Research Reference

A peptide associated with S Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...

Microbial Peptides intermediate

S Sonnei Peptide: Oligopeptide Research Reference

A peptide associated with S Sonnei for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

S Tag Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using S Tag. This analytical technique provides valuable insights into peptide structure, puri...

Purification Methods advanced

S Typhi Peptide: Oligopeptide Research Reference

A peptide associated with S Typhi for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Microbial Peptides intermediate

S Typhimurium Peptide: Oligopeptide Research Reference

A peptide associated with S Typhimurium for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

S Zooepidemicus Peptide: Oligopeptide Research Reference

A peptide associated with S Zooepidemicus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...

Microbial Peptides intermediate

S100B: Oligopeptide Research Reference

92-aa calcium-binding protein (S100B) homodimer. Released by astrocytes upon central nervous system injury. Normal: <0.10 μg/L. Elevated in traumatic brain i...

Peptide Therapeutics intermediate

Sabia N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Sabia N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Peptide Vaccines advanced

Saccharomyces cerevisiae: Oligopeptide Research Reference

Farnesylated pheromone binds Ste3p GPCR receptor. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Yeast Peptides intermediate

Sacituzumab Govitecan: Oligopeptide Research Reference

Anti-Trop-2 antibody-drug conjugate with SN-38 payload for triple-negative breast cancer and urothelial cancer. Covers molecular mechanisms, biological activ...

Peptide-Drug Conjugates advanced

Sacituzumab Tirumotecan: Oligopeptide Research Reference

Sacituzumab Tirumotecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Sacubitril-Valsartan: Oligopeptide Research Reference

Neprilysin inhibitor combined with ARB for heart failure reducing natriuretic peptide degradation. This peptide or oligopeptide is studied for its biological...

Peptide Drugs intermediate

Sacubitril: Oligopeptide Research Reference

Neprilysin inhibitor prodrug that increases natriuretic peptide levels, used with valsartan for heart failure with reduced ejection fraction.

Cardiovascular Peptides intermediate

Sacubitril: Oligopeptide Research Reference

Sacubitril is a neprilysin inhibitor prodrug that enhances natriuretic peptide levels, combined with valsartan as Entresto for heart failure with reduced eje...

Therapeutic Peptides advanced

safety-profile Resource: Oligopeptide Research Reference

The safety-profile database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

SAHB (Stabilized Alpha-Helix of BCL-2 Domains)

Comprehensive reference for SAHB (Stabilized Alpha-Helix of BCL-2 Domains), a peptide compound with applications in research and therapeutics.

Synthetic Peptides intermediate

Salmon Calcitonin Nasal Spray: Comprehensive Peptide Refe...

Intranasal formulation of synthetic salmon calcitonin for osteoporosis treatment providing bone-protective effects. Covers molecular mechanisms, biological a...

Therapeutic Peptides intermediate

Salmon Calcitonin: Oligopeptide Research Reference

32-amino acid peptide from salmon thyroid C-cells inhibiting osteoclastic bone resorption. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs intermediate

Salmon CGRP: Oligopeptide Research Reference

Salmon CGRP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Salmon GnRH: Oligopeptide Research Reference

Salmon GnRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Salmon Growth Hormone: Oligopeptide Research Reference

Salmon Growth Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Salmon Insulin: Oligopeptide Research Reference

Salmon Insulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Salmon Prolactin: Oligopeptide Research Reference

Salmon Prolactin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Salmon Somatolactin: Oligopeptide Research Reference

Salmon Somatolactin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

salt-bridge Resource: Oligopeptide Research Reference

The salt-bridge database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Salting Out Purification: Analytical Technique in Peptide...

A purification technique for separating and isolating peptides using Salting Out. This analytical technique provides valuable insights into peptide structure...

Purification Methods advanced

Sample Requirements: Oligopeptide Research Reference

Sample Requirements, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarkers Expanded intermediate

Sanger sequencing method, protein primary structure concept

Sanger sequencing method, protein primary structure concept is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Sanofi: Oligopeptide Research Reference

Lixisenatide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Peptide Patents intermediate

SANS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SANS. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

SANS for Peptides: Analytical Technique in Peptide Research

Application of SANS technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...

Structural Biology Techniques advanced

Sapecin (Sarcophaga): Oligopeptide Research Reference

Sapecin (Sarcophaga), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Sapecin B (Sarcophaga): Oligopeptide Research Reference

Sapecin B (Sarcophaga), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Sarafotoxin S6b: Peptide Toxin in Pharmacology Reference

Sarafotoxin S6b, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Sarafotoxin: Structure, Function, and Significance

Sarafotoxins are potent vasoconstrictor peptides from burrowing asp venom, structurally similar to endothelins. Covers molecular mechanisms, biological activ...

Venom Peptides intermediate

Sarafoxin: Peptide Toxin in Pharmacology Reference

sarafoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

Sarcoidosis Peptides: Oligopeptide Research Reference

Peptides associated with Sarcoidosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

Sarcoma Peptides: Oligopeptide Research Reference

Peptides associated with Sarcoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...

Disease-Associated Peptides intermediate

Sargramostim: Oligopeptide Research Reference

Recombinant GM-CSF myeloid growth factor for neutropenia and stem cell mobilization in transplant settings. This peptide or oligopeptide is studied for its b...

Hematopoietic Peptides intermediate

Sargramostim: Oligopeptide Research Reference

Recombinant GM-CSF that stimulates myeloid cell proliferation and function for neutropenia and stem cell mobilization. Covers molecular mechanisms, biologica...

Hematopoietic Peptides intermediate

Sarilumab: Oligopeptide Research Reference

sarilumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Peptide Drugs intermediate

SARS CoV 2 RBD Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting SARS CoV 2 RBD for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide Vaccines advanced

SARS CoV 2 RBD: Oligopeptide Research Reference

SARS-CoV-2-RBD is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological...

Peptide Vaccines intermediate

SARS CoV 2 S1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting SARS CoV 2 S1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Vaccines advanced

SARS CoV 2 S1: Oligopeptide Research Reference

SARS-CoV-2-S1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...

Peptide Vaccines intermediate

SASBDB: Oligopeptide Research Reference

Small Angle Scattering Biological Data Bank for SAXS/SANS data. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...

Peptide Therapeutics intermediate

Saxitoxin: Peptide Toxin in Pharmacology Reference

Saxitoxin is a potent non-peptide neurotoxin produced by dinoflagellates that blocks voltage-gated sodium channels, responsible for paralytic shellfish poiso...

Toxin Peptides advanced

SAXS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SAXS. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

SAXS for Peptide Structure: Comprehensive Peptide Reference

Understand small-angle X-ray scattering for studying peptide shape, size, and conformational ensembles in solution. Covers molecular mechanisms, biological a...

Peptide Analysis advanced

SAXS for Peptides: Analytical Technique in Peptide Research

Application of SAXS technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...

Structural Biology Techniques advanced

SCF Hormone: Endogenous Peptide Hormone Reference

SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

SCF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting SCF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

SCF Peptide Hormone: Endogenous Peptide Hormone Reference

SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

SCF Protein Hormone: Endogenous Peptide Hormone Reference

SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

scFv antibody: Oligopeptide Research Reference

Comprehensive reference for scfv antibody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

ScFv Conjugation Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using ScFv Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into ...

Peptide Synthesis Methods advanced

ScFv System 1: Oligopeptide Research Reference

A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

ScFv System 2: Oligopeptide Research Reference

A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

ScFv System 3: Oligopeptide Research Reference

A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...

Drug Delivery Systems advanced

Schistosoma Peptides: Oligopeptide Research Reference

Schistosoma Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Schizophrenia Peptides: Oligopeptide Research Reference

Peptides associated with Schizophrenia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...

Disease-Associated Peptides intermediate

Schizophrenia: Oligopeptide Research Reference

Chronic psychiatric disorder affecting ~1% of population. Positive symptoms (hallucinations, delusions, disorganized speech), negative symptoms (flat affect,...

Peptide Therapeutics intermediate

Sciex TripleTOF 6600: Oligopeptide Research Reference

High-resolution mass spectrometer for proteomics and peptidomics. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...

Peptide Therapeutics intermediate

Scleroderma Peptides: Oligopeptide Research Reference

Peptides associated with Scleroderma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...

Disease-Associated Peptides intermediate

SCOP Resource: Oligopeptide Research Reference

The SCOP database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...

Databases & Resources intermediate

SCOPe Resource: Oligopeptide Research Reference

The SCOPe database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its...

Databases & Resources intermediate

Scorpaenotoxin: Oligopeptide Research Reference

Scorpaenotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Scorpion Anticancer Peptides: Comprehensive Peptide Refer...

Scorpion-derived peptides with selective anticancer activity. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanis...

Venom Peptides intermediate

Scorpion Cardiovascular Effects

Cardiovascular effects of scorpion venom including arrhythmias and hypertension. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

Scorpion Chlorotoxin: Peptide Toxin in Pharmacology Refer...

Scorpion venom peptide binding matrix metalloproteinase-2 on glioma cells. This peptide toxin is derived from venom and studied for its pharmacological activ...

Venom Peptides intermediate

Scorpion Neurotoxicity: Peptide Toxin in Pharmacology Ref...

Mechanisms of scorpion neurotoxicity through sodium and potassium channel modulation. This peptide toxin is derived from venom and studied for its pharmacolo...

Venom Peptides intermediate

Scorpion Toxin Classification: Comprehensive Peptide Refe...

Classification of scorpion toxins by target specificity and structure. This peptide toxin is derived from venom and studied for its pharmacological activity,...

Venom Peptides intermediate

Scorpion Toxin Kv1.3 Therapy: Comprehensive Peptide Refer...

Therapeutic potential of Kv1.3-blocking scorpion toxins for autoimmune diseases. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

Scorpion Toxin Research Tools: Comprehensive Peptide Refe...

Use of scorpion toxins as pharmacological research tools. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of...

Venom Peptides intermediate

Scorpion Venom AMPs: Peptide Toxin in Pharmacology Reference

Antimicrobial peptides from scorpion venom with broad-spectrum bactericidal activity. This peptide toxin is derived from venom and studied for its pharmacolo...

Venom Peptides intermediate

Scorpion Venom Immunomodulation

Immunomodulatory properties of scorpion venom components for therapeutic development. This peptide toxin is derived from venom and studied for its pharmacolo...

Venom Peptides intermediate

Scorpion Venoms: Peptide Toxin in Pharmacology Reference

K+, Nav, Cl-, glioma. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications ...

Venom Peptides intermediate

Scorpion: Peptide Toxin in Pharmacology Reference

~4.0 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in researc...

Toxin Peptides intermediate

SDS PAGE Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SDS PAGE. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

SDS-PAGE for Peptides: Analytical Technique in Peptide Re...

Guide to SDS-polyacrylamide gel electrophoresis for separating peptides by molecular weight and assessing purity. Covers molecular mechanisms, biological act...

Peptide Analysis beginner

Sea Anemone Cytolytic Peptides

Cytolytic peptides from sea anemone causing cell membrane disruption. This peptide toxin is derived from venom and studied for its pharmacological activity, ...

Venom Peptides intermediate

Sea Anemone Kv1 Blocker: Peptide Toxin in Pharmacology Re...

Potassium channel blocker from sea anemone with neuroprotective potential. This peptide toxin is derived from venom and studied for its pharmacological activ...

Venom Peptides intermediate

Sea Anemone Neurotoxicity: Comprehensive Peptide Reference

Neurotoxic mechanisms of sea anemone venoms on nervous system. This peptide toxin is derived from venom and studied for its pharmacological activity, mechani...

Venom Peptides intermediate

Sea Anemone Toxin Anti-Inflammatory

Anti-inflammatory properties of sea anemone toxins. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of actio...

Venom Peptides intermediate

Sea Anemone Toxin ATX-I: Peptide Toxin in Pharmacology Re...

Sodium channel inactivating peptide from Anemonia sulcata. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...

Venom Peptides intermediate

Sea Anemone Toxin ATX-II: Peptide Toxin in Pharmacology R...

Sodium channel modulator from Anemonia sulcata with cardiotoxic effects. This peptide toxin is derived from venom and studied for its pharmacological activit...

Venom Peptides intermediate

Sea Anemone Toxin Cardiac: Comprehensive Peptide Reference

Cardiac effects and therapeutic potential of sea anemone toxins. This peptide toxin is derived from venom and studied for its pharmacological activity, mecha...

Venom Peptides intermediate

Sea Anemone Toxin Mechanism: Comprehensive Peptide Reference

Mechanisms of sea anemone toxin action on ion channels. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of a...

Venom Peptides intermediate

SEC (Size Exclusion Chromatography)

Comprehensive reference for SEC (Size Exclusion Chromatography), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

SEC HPLC Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using SEC HPLC. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

SEC MALS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SEC MALS. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

SEC Purification: Analytical Technique in Peptide Research

A purification technique for separating and isolating peptides using SEC. This analytical technique provides valuable insights into peptide structure, purity...

Purification Methods advanced

secondary-endpoint Resource: Comprehensive Peptide Reference

The secondary-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Secretin 1-10: Peptide Fragment Reference

Comprehensive reference for secretin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 1-14: Peptide Fragment Reference

Comprehensive reference for secretin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 1-27: Peptide Fragment Reference

Comprehensive reference for secretin 1-27 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 1-4: Peptide Fragment Reference

Comprehensive reference for secretin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 1-6: Peptide Fragment Reference

Comprehensive reference for secretin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 1-8: Peptide Fragment Reference

Comprehensive reference for secretin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 14-27: Peptide Fragment Reference

Comprehensive reference for secretin 14-27 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 20-27: Peptide Fragment Reference

Comprehensive reference for secretin 20-27 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin 8-27: Peptide Fragment Reference

Comprehensive reference for secretin 8-27 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Secretin Family Peptides: Oligopeptide Research Reference

Overview of secretin family peptides including secretin, VIP, PACAP, and GIP in gastrointestinal function. This peptide or oligopeptide is studied for its bi...

Peptide Families intermediate

Secretin Hormone: Endogenous Peptide Hormone Reference

Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Secretin Peptide Hormone: Endogenous Peptide Hormone Refe...

Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Secretin Protein Hormone: Endogenous Peptide Hormone Refe...

Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Secretin: Endogenous Peptide Hormone Reference

27-amino acid gut hormone that stimulates pancreatic bicarbonate secretion and regulates gastric acid output. This peptide or oligopeptide is studied for its...

Gastrointestinal Peptides beginner

Secukinumab: Oligopeptide Research Reference

secukinumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Seed amplification assay: Oligopeptide Research Reference

Alpha-synuclein (PD). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...

Biomarkers Expanded intermediate

selectivity Resource: Oligopeptide Research Reference

The selectivity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Selenium Peptide: Oligopeptide Research Reference

selenium peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Antioxidant Peptides intermediate

Self Assembling Synthesis: Comprehensive Peptide Reference

A peptide synthesis method using Self Assembling for producing peptides with specific properties. This analytical technique provides valuable insights into p...

Peptide Synthesis Methods advanced

Self Attention for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Self Attention. This analytical technique provides valuable insights into peptide structure, purity, and c...

Computational Methods advanced

Self-assembling peptides, biosensors, green chemistry

Metric. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...

Peptide Applications intermediate

self-assembly for Peptides: Comprehensive Peptide Reference

Application of self-assembly technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its...

Structural Biology Techniques advanced

Self-Emulsifying Peptide Delivery

Discover SEDDS formulations for enhancing oral bioavailability of lipophilic peptide drugs. This peptide or oligopeptide is studied for its biological activi...

Drug Delivery advanced

Semaglutide (Oral): Oligopeptide Research Reference

Semaglutide (Oral), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Semaglutide 2.4mg Obesity: Comprehensive Peptide Reference

Higher-dose semaglutide approved for chronic weight management in adults with obesity. This peptide or oligopeptide is studied for its biological activity, s...

Peptide Drugs intermediate

Semaglutide 3-Month Dosing: Comprehensive Peptide Reference

Extended dosing interval option for semaglutide allowing three-month intervals between injections. This peptide or oligopeptide is studied for its biological...

GLP-1 Family advanced

Semaglutide Insulin Coformulation

Experimental co-formulation of semaglutide with ultra-long-acting insulin for single-injection therapy. This peptide or oligopeptide is studied for its biolo...

Peptide Drugs advanced

Semaglutide vs Tirzepatide: Comprehensive Peptide Reference

Comparative pharmacological analysis of semaglutide (GLP-1 RA) and tirzepatide (dual GIP/GLP-1 agonist) in the treatment of obesity and type 2 diabetes mellitus

GLP-1 Analogs intermediate

Semaglutide: Oligopeptide Research Reference

semaglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Semaglutide: Therapeutic Peptide Drug Profile

A long-acting glucagon-like peptide-1 (GLP-1) receptor agonist used for type 2 diabetes and obesity treatment, featuring Aib8 substitution and C-18 fatty dia...

Peptide Drugs intermediate

Semaphorin 3A Inhibitor: Oligopeptide Research Reference

semaphorin 3A inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Neurological Peptides intermediate

Semi Empirical for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Semi Empirical. This analytical technique provides valuable insights into peptide structure, purity, and c...

Computational Methods advanced

Semorinemab: Oligopeptide Research Reference

Semorinemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

sensitivity Resource: Oligopeptide Research Reference

The sensitivity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

Sepsis and Peptides: Oligopeptide Research Reference

Explore antimicrobial and immunomodulatory peptides for managing sepsis and systemic inflammatory responses. This peptide or oligopeptide is studied for its ...

Peptide Therapeutics advanced

Sepsis: Oligopeptide Research Reference

Sepsis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Infectious intermediate

Sericin (Bombyx): Oligopeptide Research Reference

Sericin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Serine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Serine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...

Amino Acid Metabolism intermediate

Serine Modification: Post-Translational Modification Refe...

Post-translational modifications of Serine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...

Amino Acid Modifications intermediate

Serine Peptide: Oligopeptide Research Reference

Serine (S) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...

Amino Acid Peptides beginner

Serine protease involved in egress from RBCs

Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Protist Peptides intermediate

serious-adverse-event Resource

The serious-adverse-event database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Sermorelin: Oligopeptide Research Reference

Synthetic GHRH(1-29) analog for GH stimulation testing and potential deficiency treatment. This peptide or oligopeptide is studied for its biological activit...

Peptide Drugs beginner

Sesame Peptide: Oligopeptide Research Reference

A bioactive peptide derived from sesame with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Shallot Peptide: Oligopeptide Research Reference

A bioactive peptide derived from shallot with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

shape-complementarity Resource

The shape-complementarity database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Sheep Cathelicidin SMAP-29: Comprehensive Peptide Reference

Potent cathelicidin from sheep neutrophils with activity against resistant bacteria. This antimicrobial peptide demonstrates activity against pathogens and i...

Antimicrobial Peptides intermediate

Sheep Cathelicidin: Oligopeptide Research Reference

Sheep Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Sheet Assembly System 1: Oligopeptide Research Reference

A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Sheet Assembly System 2: Oligopeptide Research Reference

A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Sheet Assembly System 3: Oligopeptide Research Reference

A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Shell Matrix Peptides: Oligopeptide Research Reference

Shell Matrix Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Shimadzu Prominence: Oligopeptide Research Reference

HPLC system for analytical and preparative peptide purification. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

ShK (Stichodactyla helianthus K+ channel toxin)

Comprehensive reference for ShK (Stichodactyla helianthus K+ channel toxin), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

ShK: Peptide Toxin in Pharmacology Reference

ShK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

Shrimp Antimicrobial Peptides: Comprehensive Peptide Refe...

AMPs in shrimp hemocytes defending against aquaculture pathogens. This antimicrobial peptide demonstrates activity against pathogens and is studied for its m...

Antimicrobial Peptides intermediate

Side Chain Cyclization (Disulfide)

Formation of disulfide bond between two cysteine residues. Stabilizes structure. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Side Chain Cyclization (Lactam)

Formation of lactam bridge between side chain functional groups. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

Side Chain Mod System 1: Oligopeptide Research Reference

A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Side Chain Mod System 2: Oligopeptide Research Reference

A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Side Chain Mod System 3: Oligopeptide Research Reference

A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...

Drug Delivery Systems advanced

Side Chain: Post-Translational Modification Reference

Transient. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized thera...

Peptide Modifications intermediate

Sigma Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...

sigma-conotoxin-GVIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Sigma-Conotoxin MrIA: Peptide Toxin in Pharmacology Refer...

Serotonin transporter inhibitor from Conus marmoreus with antidepressant potential. This peptide toxin is derived from venom and studied for its pharmacologi...

Venom Peptides intermediate

Signal transduction: Oligopeptide Research Reference

Comprehensive reference for signal transduction, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Signaling Peptides: Oligopeptide Research Reference

Quorum sensing modulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Bacterial Peptides intermediate

Silica Nanoparticle Labeling Synthesis

A peptide synthesis method using Silica Nanoparticle Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for it...

Peptide Synthesis Methods advanced

Silk Elastin Copolymer: Oligopeptide Research Reference

silk elastin copolymer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Structural Peptides intermediate

Silk Fibroin: Oligopeptide Research Reference

The main structural protein of silk, composed of repetitive GAGAGS sequences that form beta-sheet crystalline structures, with applications in biomedical eng...

Structural Peptides intermediate

Silk Protein / Structural: Comprehensive Peptide Reference

Silk Protein / Structural is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...

Insect Peptides intermediate

Silk Proteins: Oligopeptide Research Reference

Structural, biomaterial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Insect Peptides intermediate

SIMS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SIMS. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

Single molecule array: Oligopeptide Research Reference

Ultra-sensitive (neuro). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...

Biomarkers Expanded intermediate

Single-domain antibody: Oligopeptide Research Reference

Comprehensive reference for single-domain antibody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

siRNA delivery: Oligopeptide Research Reference

Comprehensive reference for sirna delivery, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

SiRNA System 1: Oligopeptide Research Reference

A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

SiRNA System 2: Oligopeptide Research Reference

A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

SiRNA System 3: Oligopeptide Research Reference

A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...

Drug Delivery Systems advanced

Sirolimus: Oligopeptide Research Reference

Macrolide immunosuppressant that inhibits mTOR to block T-cell proliferation in transplant rejection and coronary stent coatings.

Immunomodulatory Peptides advanced

SIRP Alpha Antagonist: Oligopeptide Research Reference

SIRP alpha antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Immune Peptides intermediate

Size Exclusion Analysis: Analytical Technique in Peptide ...

An analytical technique for characterizing peptides using Size Exclusion. This analytical technique provides valuable insights into peptide structure, purity...

Analytical Techniques advanced

Size Exclusion Chromatography (SEC)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Skin AMP Cocktail: Antimicrobial Peptide Reference

Combination of dermcidin, defensins, and cathelicidin on skin surface. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...

Antimicrobial Peptides intermediate

Skin Brightening: Oligopeptide Research Reference

Peptide-based skin brightening approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Peptide Therapeutics intermediate

Skin Disease and Peptides: Comprehensive Peptide Reference

Learn about cosmetic and therapeutic peptides for skin conditions including psoriasis, eczema, and aging. This peptide or oligopeptide is studied for its bio...

Peptide Therapeutics beginner

Sleep / Neurological: Oligopeptide Research Reference

Sleep / Neurological is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...

Peptide Interactions intermediate

Sleep-Wake Neuropeptides: Neuropeptide in Neuroscience Re...

Neuropeptides regulating circadian rhythms and sleep-wake transitions. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides intermediate

Slit 2 Inhibitor: Oligopeptide Research Reference

slit 2 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Neurological Peptides intermediate

SMAP 34: Antimicrobial Peptide Reference

SMAP-34 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

SMAP-29: Oligopeptide Research Reference

SMAP-29, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

SMART Resource: Oligopeptide Research Reference

The SMART database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its...

Databases & Resources intermediate

Smart Responsive Peptide Delivery

Discover stimuli-responsive delivery systems that release peptides in response to pH, temperature, or enzymes. This peptide or oligopeptide is studied for it...

Drug Delivery advanced

Snake Venom Peptides: Oligopeptide Research Reference

Neurology, Cardiovascular, Research Tools. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Reptile Peptides intermediate

Snake Venoms: Peptide Toxin in Pharmacology Reference

nAChR, Nav, PLA2, K+, ET receptors. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential...

Venom Peptides intermediate

Snake: Peptide Toxin in Pharmacology Reference

0.03 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in researc...

Toxin Peptides intermediate

Snakin: Oligopeptide Research Reference

Snakin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

SNAP-8: Oligopeptide Research Reference

Acetyl octapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala). Extended analog of Argireline with additional alanine residue. Inhibits SNARE complex formation. Anti-...

Peptide Therapeutics intermediate

So-D1: Oligopeptide Research Reference

So-D1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Social Behavior Neuropeptides: Comprehensive Peptide Refe...

Neuropeptides mediating social bonding, recognition, and interaction. This neuropeptide is involved in neurological signaling and is studied for its roles in...

Neuropeptides intermediate

Soil Health: Oligopeptide Research Reference

Use of antimicrobial peptides for soil health. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...

Peptide Therapeutics intermediate

sol for Peptides: Analytical Technique in Peptide Research

Application of sol technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...

Structural Biology Techniques advanced

Solenopsin (Solenopsis): Oligopeptide Research Reference

Solenopsin (Solenopsis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Solid Lipid Nanoparticles Peptide

Solid lipid nanoparticles for controlled peptide release and protection. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Drug Delivery intermediate

Solid Phase Peptide Synthesis (SPPS)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Solid Phase Synthesis: Analytical Technique in Peptide Re...

A peptide synthesis method using Solid Phase for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...

Peptide Synthesis Methods advanced

Solid-Phase Peptide Synthesis: Comprehensive Peptide Refe...

Comprehensive resource on SPPS methods and applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Soliqua/Suliqua Co-Formulation Technology

Dual-chamber pen device technology enabling stable co-formulation of insulin glargine and lixisenatide. This peptide or oligopeptide is studied for its biolo...

Insulin Family advanced

Solithromycin: Oligopeptide Research Reference

Solithromycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

solvent-accessible Resource: Comprehensive Peptide Reference

The solvent-accessible database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Somapacitan: Oligopeptide Research Reference

Long-acting growth hormone albumin-binding prodrug for once-weekly dosing. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide Drugs intermediate

Somatostatin → SSTR2: Oligopeptide Research Reference

Somatostatin → SSTR2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Somatostatin 1-10: Peptide Fragment Reference

Comprehensive reference for somatostatin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 1-12: Peptide Fragment Reference

Comprehensive reference for somatostatin 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 1-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 1-28: Peptide Fragment Reference

Comprehensive reference for somatostatin 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 1-8: Peptide Fragment Reference

Comprehensive reference for somatostatin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 11-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 11-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 13-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 13-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 5-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 5-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 7-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 7-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin 9-14: Peptide Fragment Reference

Comprehensive reference for somatostatin 9-14 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Somatostatin Analog: Oligopeptide Research Reference

somatostatin analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Reproductive Peptides intermediate

Somatostatin Analog: Oligopeptide Research Reference

Somatostatin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...

Peptide Clinical Trials intermediate

Somatostatin Central: Neuropeptide in Neuroscience Reference

Hypothalamic and GI peptide inhibiting growth hormone and multiple secretory functions. This neuropeptide is involved in neurological signaling and is studie...

Neuropeptides beginner

Somatostatin Family Peptides: Comprehensive Peptide Refer...

Learn about somatostatin and cortistatin peptides in hormone inhibition and neuromodulation. This endogenous peptide hormone plays important roles in physiol...

Peptide Families intermediate

Somatostatin Hormone: Endogenous Peptide Hormone Reference

Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Somatostatin Peptide Hormone: Comprehensive Peptide Refer...

Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Somatostatin Protein Hormone: Comprehensive Peptide Refer...

Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Somatostatin-14: Neuropeptide in Neuroscience Reference

Somatostatin-14, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Somatostatin: Oligopeptide Research Reference

A 14-amino acid cyclic neuropeptide that inhibits growth hormone release, modulates GI function, and serves as the prototype for long-acting analogs like oct...

Peptide Hormones intermediate

Somatropin: Oligopeptide Research Reference

somatropin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Somatropin: Oligopeptide Research Reference

Recombinant human growth hormone identical to endogenous 191 amino acid pituitary GH. This peptide or oligopeptide is studied for its biological activity, st...

Peptide Drugs beginner

Sonochemical Synthesis: Analytical Technique in Peptide R...

A peptide synthesis method using Sonochemical for producing peptides with specific properties. This analytical technique provides valuable insights into pept...

Peptide Synthesis Methods advanced

Sonophoresis Peptide Delivery: Comprehensive Peptide Refe...

Discover ultrasound-mediated transdermal peptide delivery using cavitation and acoustic streaming effects. This peptide or oligopeptide is studied for its bi...

Drug Delivery advanced

Sorghum Peptide: Oligopeptide Research Reference

A bioactive peptide derived from sorghum with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Soy Lunasin: Oligopeptide Research Reference

soy lunasin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Food-Derived Peptides intermediate

Soy Peptide: Oligopeptide Research Reference

A bioactive peptide derived from soy with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...

Plant-Derived Peptides intermediate

Soy Soystatin: Oligopeptide Research Reference

soy soystatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Food-Derived Peptides intermediate

Soyacystatin: Oligopeptide Research Reference

Soyacystatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Soymilk Peptide: Oligopeptide Research Reference

soymilk-peptide is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.

Food-Derived Peptides intermediate

Soymorphin-5: Oligopeptide Research Reference

Met-enkephalin analog derived from soy β-conglycinin. Opioid activity. Found in soy protein digests. May contribute to neuroactive effects of soy consumption.

Peptide Therapeutics intermediate

Soystatin: Structure, Function, and Significance

Soystatin is an ACE-inhibitory peptide from soy protein hydrolysates with antihypertensive activity. This peptide or oligopeptide is studied for its biologic...

Food-Derived Peptides intermediate

Special Populations: Oligopeptide Research Reference

Dose adjustment required. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Safety intermediate

specificity Resource: Oligopeptide Research Reference

The specificity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...

Databases & Resources intermediate

spectroscopy for Peptides: Comprehensive Peptide Reference

Application of spectroscopy technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...

Structural Biology Techniques advanced

Spexin: Neuropeptide in Neuroscience Reference

Novel neuropeptide with anorexigenic and GI motility effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...

Neuropeptides intermediate

Spider Anticancer Peptides: Comprehensive Peptide Reference

Spider venom peptides with selective toxicity against cancer cells. This peptide toxin is derived from venom and studied for its pharmacological activity, me...

Venom Peptides intermediate

Spider Toxin Ca2+ Channel Modulators

Calcium channel modulating peptides from spider venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of ac...

Venom Peptides intermediate

Spider Toxin CNS Targets: Peptide Toxin in Pharmacology R...

Spider venom peptides targeting central nervous system ion channels. This peptide toxin is derived from venom and studied for its pharmacological activity, m...

Venom Peptides intermediate

Spider Toxin Diversity: Peptide Toxin in Pharmacology Ref...

Diversity of spider venom peptides and their pharmacological targets. This peptide toxin is derived from venom and studied for its pharmacological activity, ...

Venom Peptides intermediate

Spider Toxin HNTX-I: Peptide Toxin in Pharmacology Reference

TRPV1 antagonist from Chinese bird spider with analgesic potential. This peptide toxin is derived from venom and studied for its pharmacological activity, me...

Venom Peptides intermediate

Spider Toxin Insecticidal: Comprehensive Peptide Reference

Insecticidal spider venom peptides for pest control applications. This peptide toxin is derived from venom and studied for its pharmacological activity, mech...

Venom Peptides intermediate

Spider Toxin Ion Channel Studies

Use of spider toxins as tools to study ion channel function. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism...

Venom Peptides intermediate

Spider Toxin JZTX-I: Peptide Toxin in Pharmacology Reference

Sodium channel modulator from Jinzo spider affecting neuronal excitability. This peptide toxin is derived from venom and studied for its pharmacological acti...

Venom Peptides intermediate

Spider Toxin K+ Channel Blockers

Potassium channel blocking peptides from spider venom for neurological research. This peptide toxin is derived from venom and studied for its pharmacological...

Venom Peptides intermediate

Spider Toxin PhTx3: Peptide Toxin in Pharmacology Reference

Potent glutamate receptor antagonist from Phoneutria nigriventer for pain. This peptide toxin is derived from venom and studied for its pharmacological activ...

Venom Peptides intermediate

Spider Venom AMPs: Peptide Toxin in Pharmacology Reference

AMPs from spider venom with activity against bacteria and fungi. This peptide toxin is derived from venom and studied for its pharmacological activity, mecha...

Venom Peptides intermediate

Spider Venoms: Peptide Toxin in Pharmacology Reference

Cav, Nav, K+, glutamate, nAChR. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential app...

Venom Peptides intermediate

Spider: Peptide Toxin in Pharmacology Reference

~0.05 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...

Toxin Peptides intermediate

Spidroin I (Nephila): Oligopeptide Research Reference

Spidroin I (Nephila), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Spidroin II (Nephila): Oligopeptide Research Reference

Spidroin II (Nephila), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Insect Peptides intermediate

Spinach Peptide: Oligopeptide Research Reference

A bioactive peptide derived from spinach with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Plant-Derived Peptides intermediate

Spinning Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Spinning for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...

Peptide Synthesis Methods advanced

Spodoptericin (Spodoptera): Comprehensive Peptide Reference

Comprehensive reference for Spodoptericin (Spodoptera), a peptide compound with applications in research and therapeutics.

Insect Peptides intermediate

SPPS (1963), Fmoc chemistry development

SPPS (1963), Fmoc chemistry development is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...

Peptide History intermediate

SPPS (Solid Phase Peptide Synthesis)

Comprehensive reference for SPPS (Solid Phase Peptide Synthesis), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

SPPS Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using SPPS for producing peptides with specific properties. This analytical technique provides valuable insights into peptide stru...

Peptide Synthesis Methods advanced

SPR Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using SPR. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Analytical Techniques advanced

SPR for Peptide Binding: Analytical Technique in Peptide ...

Explore surface plasmon resonance for real-time measurement of peptide binding kinetics and affinity interactions. Covers molecular mechanisms, biological ac...

Peptide Analysis advanced

Spray Drying Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Spray Drying. This analytical technique provides valuable insights into peptide structur...

Purification Methods advanced

Spray Drying: Oligopeptide Research Reference

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Formulation intermediate

spray-drying for Peptides: Comprehensive Peptide Reference

Application of spray-drying technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...

Structural Biology Techniques advanced

Squash Peptide: Oligopeptide Research Reference

A bioactive peptide derived from squash with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

SRC Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting SRC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Src Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Src Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Src Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Src Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Src Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

stability Resource: Oligopeptide Research Reference

The stability database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...

Databases & Resources intermediate

Stability Testing for Peptides

Guide to stability testing protocols and ICH conditions for establishing peptide drug shelf life and storage conditions.

Regulatory intermediate

Stability Testing: Oligopeptide Research Reference

Stability Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

stable-disease Resource: Oligopeptide Research Reference

The stable-disease database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Stamping Synthesis: Analytical Technique in Peptide Research

A peptide synthesis method using Stamping for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...

Peptide Synthesis Methods advanced

Stapled Peptide: Oligopeptide Research Reference

Stapled Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ac...

Peptide Clinical Trials intermediate

Stapled Peptides in Cancer: Comprehensive Peptide Reference

An overview of hydrocarbon stapled peptides as cancer therapeutics, covering MDM2/MDMX inhibition, BCL-2 family targeting, and ALRN-6924 clinical development.

Oncology advanced

Stapled Peptides: Oligopeptide Research Reference

Alpha-helix stabilized peptides for PPI inhibition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...

Synthetic Peptides intermediate

Stapled System 1: Oligopeptide Research Reference

A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Stapled System 2: Oligopeptide Research Reference

A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Stapled System 3: Oligopeptide Research Reference

A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...

Drug Delivery Systems advanced

Stapling System 1: Oligopeptide Research Reference

A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Stapling System 2: Oligopeptide Research Reference

A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Stapling System 3: Oligopeptide Research Reference

A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

STAT Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting STAT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

Steered MD for Peptides: Analytical Technique in Peptide ...

A computational method for studying peptides using Steered MD. This analytical technique provides valuable insights into peptide structure, purity, and chara...

Computational Methods advanced

Stentor coeruleus: Oligopeptide Research Reference

Photosensitizer, generates singlet oxygen. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Protist Peptides intermediate

Sterility Testing (Microbial Limits)

>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...

Peptide Manufacturing intermediate

Sterility Testing: Oligopeptide Research Reference

Sterility Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Manufacturing intermediate

Stevioside: Oligopeptide Research Reference

stevioside in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Agricultural Peptides intermediate

STING Peptide Conjugates: Oligopeptide Research Reference

Comprehensive reference for STING Peptide Conjugates, a peptide compound with applications in research and therapeutics.

Peptide Drug Conjugates intermediate

Stonustoxin: Oligopeptide Research Reference

Stonustoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Strained Alkyne Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Strained Alkyne. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Strawberry Peptide: Oligopeptide Research Reference

A bioactive peptide derived from strawberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Plant-Derived Peptides intermediate

Streptavidin Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Streptavidin. This analytical technique provides valuable insights into peptide structur...

Purification Methods advanced

Stress Response Peptides: Neuropeptide in Neuroscience Re...

Neuropeptides coordinating hypothalamic-pituitary-adrenal stress response. This neuropeptide is involved in neurological signaling and is studied for its rol...

Neuropeptides intermediate

Stroke Peptides: Oligopeptide Research Reference

Peptides associated with Stroke including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...

Disease-Associated Peptides intermediate

Stroke: Oligopeptide Research Reference

Cerebrovascular accident. Ischemic (85%) or hemorrhagic (15%). This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Subcutaneous Peptide Delivery: Comprehensive Peptide Refe...

Understand subcutaneous injection methods for sustained peptide drug delivery including depot formulations. This peptide or oligopeptide is studied for its b...

Drug Delivery beginner

Sublingual Peptide Delivery: Comprehensive Peptide Reference

Sublingual administration for rapid systemic peptide absorption. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Drug Delivery intermediate

Substance K: Neuropeptide in Neuroscience Reference

Substance K is a tachykinin neuropeptide that activates NK2 receptors to mediate smooth muscle contraction and inflammatory responses in mammalian tissues.

Neuropeptides intermediate

Substance P → ACE (Substrate): Comprehensive Peptide Refe...

Comprehensive reference for Substance P → ACE (Substrate), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Substance P: Neuropeptide in Neuroscience Reference

An undecapeptide neuropeptide of the tachykinin family that functions as a neurotransmitter and neuromodulator in the central and peripheral nervous systems,...

Neuropeptides intermediate

Subtilin: Antimicrobial Peptide Reference

subtilin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...

Antimicrobial Peptides intermediate

Sufentanil Synthetic Opioid: Comprehensive Peptide Reference

Potent synthetic opioid with greater mu-selectivity than fentanyl. This neuropeptide is involved in neurological signaling and is studied for its roles in br...

Neuropeptides intermediate

Sufentanil: Oligopeptide Research Reference

Sufentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Sulodexide: Oligopeptide Research Reference

Glycosaminoglycan mixture of heparan sulfate and dermatan sulfate for diabetic nephropathy. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs beginner

SUMO Tag Purification: Analytical Technique in Peptide Re...

A purification technique for separating and isolating peptides using SUMO Tag. This analytical technique provides valuable insights into peptide structure, p...

Purification Methods advanced

Sun Protection: Oligopeptide Research Reference

Peptide-based UV protection approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

Sunflower Peptide: Oligopeptide Research Reference

A bioactive peptide derived from sunflower with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...

Plant-Derived Peptides intermediate

Sunvozertinib: Oligopeptide Research Reference

Sunvozertinib, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Superoxide Dismutase Mn: Oligopeptide Research Reference

superoxide dismutase mn in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Antioxidant Peptides intermediate

supramolecular for Peptides: Comprehensive Peptide Reference

Application of supramolecular technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Surface Modification Synthesis

A peptide synthesis method using Surface Modification for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...

Peptide Synthesis Methods advanced

Surface-Enhanced Raman for Peptides

Explore SERS techniques for ultrasensitive peptide detection using metallic nanostructure signal enhancement. This peptide or oligopeptide is studied for its...

Peptide Analysis advanced

surface-exposure Resource: Comprehensive Peptide Reference

The surface-exposure database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

surface-plasmon-resonance for Peptides

Application of surface-plasmon-resonance technique for peptide characterization, structure determination, or formulation.

Structural Biology Techniques advanced

surrogate-endpoint Resource: Comprehensive Peptide Reference

The surrogate-endpoint database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Suruvatide: Oligopeptide Research Reference

Suruvatide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

survival Resource: Oligopeptide Research Reference

The survival database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Survivin Peptide: Oligopeptide Research Reference

survivin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Diagnostic Peptides intermediate

Survodutide: Oligopeptide Research Reference

Dual glucagon/GLP-1 receptor agonist for obesity and metabolic dysfunction-associated steatohepatitis. This peptide or oligopeptide is studied for its biolog...

Peptide Drugs advanced

SYN-001: Oligopeptide Research Reference

Industry standard, automated. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...

Peptide Manufacturing intermediate

SYN-002: Oligopeptide Research Reference

Large scale, solution phase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Manufacturing intermediate

SYN-003: Oligopeptide Research Reference

Complex proteins, PTMs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Peptide Manufacturing intermediate

SYN-004: Oligopeptide Research Reference

Non-natural AAs, rapid. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...

Peptide Manufacturing intermediate

SYN-005: Oligopeptide Research Reference

Green chemistry, stereocontrol. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Manufacturing intermediate

SYN-006: Oligopeptide Research Reference

Fast, difficult sequences. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Peptide Manufacturing intermediate

SYN-007: Oligopeptide Research Reference

Continuous, PAT integration. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Manufacturing intermediate

SYN-008: Oligopeptide Research Reference

Long peptides, convergent. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...

Peptide Manufacturing intermediate

SYN-009: Oligopeptide Research Reference

Proteins, chemoselective. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Peptide Manufacturing intermediate

SYN-010: Oligopeptide Research Reference

Conjugation, bioconjugation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...

Peptide Manufacturing intermediate

Syn-Ake: Oligopeptide Research Reference

Diaminobutyryl benzylamide. Synthetic tripeptide mimicking Waglerin-1 from temple viper (Tropidolaemus wagleri) venom. Competitively blocks nicotinic acetylc...

Peptide Therapeutics intermediate

Syn-Hycan: Oligopeptide Research Reference

Acetyl hexapeptide-30. Inhibits acetylcholine release at neuromuscular junction. Reduces muscle contractions. Used in anti-aging skincare.

Peptide Therapeutics intermediate

Syn-Tacks: Oligopeptide Research Reference

Acetyl hexapeptide-38. Inhibits neurotransmitter release. Reduces expression lines. Used in cosmetic formulations. Covers molecular mechanisms, biological ac...

Peptide Therapeutics intermediate

Synthesis (10 processes): Oligopeptide Research Reference

Comprehensive reference for Synthesis (10 processes), a peptide compound with applications in research and therapeutics.

Peptide Manufacturing intermediate

Synthesis Technologies: Oligopeptide Research Reference

Methods for peptide bond formation and assembly. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Technologies intermediate

Synthesis Technology Comparison

Comparison of different peptide synthesis technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...

Peptide Therapeutics intermediate

Synthetase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Synthetase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...

Peptide-Drug Conjugates advanced

Synthetic Defensin Mimetics: Comprehensive Peptide Reference

Rationally designed synthetic peptides mimicking defensin structure and function. This antimicrobial peptide demonstrates activity against pathogens and is s...

Antimicrobial Peptides advanced

Systemin: Oligopeptide Research Reference

Systemin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

T Pallidum Peptide: Oligopeptide Research Reference

A peptide associated with T Pallidum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...

Microbial Peptides intermediate

T SNE for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using T SNE. This analytical technique provides valuable insights into peptide structure, purity, and characteri...

Computational Methods advanced

T-cerulein: Antimicrobial Peptide Reference

T-cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

T-Kinin: Antimicrobial Peptide Reference

T-Kinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

T5 for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using T5. This analytical technique provides valuable insights into peptide structure, purity, and characterizat...

Computational Methods advanced

Tachykinin Family Peptides: Comprehensive Peptide Reference

Guide to substance P, neurokinin A, and neurokinin B in pain transmission and neuroinflammation. This peptide or oligopeptide is studied for its biological a...

Peptide Families intermediate

Tachykinin Like: Peptide Toxin in Pharmacology Reference

tachykinin-like is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for ...

Venom Peptides intermediate

Tachyplesin: Antimicrobial Peptide Reference

AMP from horseshoe crab hemocytes with beta-sheet structure and membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathog...

Antimicrobial Peptides intermediate

Tachystatin: Antimicrobial Peptide Reference

Chitin-binding antimicrobial protein from horseshoe crab providing innate defense against fungi. This antimicrobial peptide demonstrates activity against pat...

Antimicrobial Peptides intermediate

Tacrolimus: Oligopeptide Research Reference

Macrolide calcineurin inhibitor from Streptomyces tsukubaensis used as an immunosuppressant in organ transplantation and atopic dermatitis.

Immunomodulatory Peptides advanced

Taenia Peptides: Oligopeptide Research Reference

Taenia Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Worm Peptides intermediate

Taipoxin: Peptide Toxin in Pharmacology Reference

Taipoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Tamiami N Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Tamiami N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Vaccines advanced

TAP: Oligopeptide Research Reference

TAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Mammalian Peptides intermediate

Tapentadol Dual Mechanism: Comprehensive Peptide Reference

Opioid agonist and norepinephrine reuptake inhibitor for moderate to severe pain. This neuropeptide is involved in neurological signaling and is studied for ...

Neuropeptides beginner

Targeted delivery: Oligopeptide Research Reference

Comprehensive reference for targeted delivery, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Targeted System 1: Oligopeptide Research Reference

A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Targeted System 2: Oligopeptide Research Reference

A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Targeted System 3: Oligopeptide Research Reference

A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

TAT Peptide (47-57): Oligopeptide Research Reference

TAT Peptide (47-57), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Tau (Phosphorylated): Oligopeptide Research Reference

Hyperphosphorylated tau. Neurofibrillary tangles in Alzheimer's disease. This peptide or oligopeptide is studied for its biological activity, structure-activ...

Peptide Therapeutics intermediate

Tau Aggregation (Self-association)

Comprehensive reference for Tau Aggregation (Self-association), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Tau aggregation: Oligopeptide Research Reference

Comprehensive reference for tau aggregation, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Tau Conotoxin TxVIIA: Peptide Toxin in Pharmacology Refer...

tau-conotoxin-TxVIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...

Venom Peptides intermediate

Tau Phosphorylated: Oligopeptide Research Reference

tau phosphorylated in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Diagnostic Peptides intermediate

TB Ag85A Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting TB Ag85A for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

TB Ag85A: Oligopeptide Research Reference

TB-Ag85A is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activ...

Peptide Vaccines intermediate

TB MPT64 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting TB MPT64 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

TB MPT64: Oligopeptide Research Reference

TB-MPT64 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activ...

Peptide Vaccines intermediate

TCA Precipitation Purification

A purification technique for separating and isolating peptides using TCA Precipitation. This analytical technique provides valuable insights into peptide str...

Purification Methods advanced

TCGA: Oligopeptide Research Reference

The Cancer Genome Atlas for cancer genomics data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Therapeutics intermediate

Teduglutide: Oligopeptide Research Reference

GLP-2 analog resistant to DPP-4 degradation for short bowel syndrome, reducing parenteral nutrition dependence. Covers molecular mechanisms, biological activ...

Gastrointestinal Peptides advanced

Teicoplanin: Antimicrobial Peptide Reference

Glycopeptide antibiotic from Actinoplanes teichomyceticus with long half-life, used for gram-positive infections including MRSA.

Antimicrobial Peptides intermediate

Teixobactin Analog: Oligopeptide Research Reference

Teixobactin Analog, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Telavancin: Antimicrobial Peptide Reference

Lipoglycopeptide antibiotic with dual mechanism inhibiting cell wall synthesis and disrupting membrane potential in gram-positive bacteria.

Antimicrobial Peptides intermediate

Telavancin: Oligopeptide Research Reference

telavancin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Telomerase Peptide: Oligopeptide Research Reference

telomerase peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Diagnostic Peptides intermediate

Temporin 1a: Antimicrobial Peptide Reference

temporin-1a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Temporin 1b: Antimicrobial Peptide Reference

temporin-1b is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...

Antimicrobial Peptides intermediate

Temporin 1ce: Structure, Function, and Significance

Temporin-1Ce is one of the most potent temporins, showing activity against drug-resistant bacteria including MRSA. Covers molecular mechanisms, biological ac...

Antimicrobial Peptides intermediate

Temporin 1OG: Antimicrobial Peptide Reference

temporin-1OG is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...

Antimicrobial Peptides intermediate

Temporin 1OMa: Antimicrobial Peptide Reference

temporin-1OMa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...

Antimicrobial Peptides intermediate

Temporin 1Ta: Antimicrobial Peptide Reference

temporin-1Ta is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...

Antimicrobial Peptides intermediate

Temporin 1Td: Antimicrobial Peptide Reference

temporin-1Td is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...

Antimicrobial Peptides intermediate

Temporin 1Tl: Antimicrobial Peptide Reference

temporin-1Tl is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...

Antimicrobial Peptides intermediate

Temporin A: Antimicrobial Peptide Reference

Shortest known natural antimicrobial peptide from frog skin with potent activity against gram-positive bacteria. Covers molecular mechanisms, biological acti...

Antimicrobial Peptides beginner

Temporin A: Antimicrobial Peptide Reference

Tridecapeptide from red frog skin with potent gram-positive bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is ...

Antimicrobial Peptides intermediate

Temporin B: Antimicrobial Peptide Reference

Tridecapeptide from temporin family with antimicrobial activity in frog skin secretions. This antimicrobial peptide demonstrates activity against pathogens a...

Antimicrobial Peptides intermediate

Temporin L: Antimicrobial Peptide Reference

Potent frog AMP with activity against MRSA and efficacy in infection models. This antimicrobial peptide demonstrates activity against pathogens and is studie...

Antimicrobial Peptides intermediate

Temporin: Structure, Function, and Significance

Temporins are short (10-14 aa) antimicrobial peptides from frog skin. They are among the smallest known AMPs with potent antibacterial activity.

Antimicrobial Peptides intermediate

Tepotinib: Oligopeptide Research Reference

Tepotinib, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Teriparatide Biosimilar: Oligopeptide Research Reference

Biosimilar recombinant PTH(1-34) for osteoporosis with equivalent bone formation effects. This peptide or oligopeptide is studied for its biological activity...

Peptide Drugs intermediate

Teriparatide: Oligopeptide Research Reference

teriparatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

Teriparatide: Oligopeptide Research Reference

Recombinant PTH(1-34) for osteoporosis stimulating osteoblast-mediated bone formation via PTH1R. This peptide or oligopeptide is studied for its biological a...

Peptide Drugs intermediate

Teriparatide: Oligopeptide Research Reference

Recombinant PTH(1-34) that stimulates osteoblast activity for osteoporosis treatment, the first anabolic bone agent. Covers molecular mechanisms, biological ...

Bone-Active Peptides intermediate

Terlipressin: Oligopeptide Research Reference

Glypressin analog for hepatorenal syndrome providing selective splanchnic vasoconstriction. This peptide or oligopeptide is studied for its biological activi...

Peptide Drugs intermediate

Tesamorelin: Oligopeptide Research Reference

Synthetic GHRH analog for HIV-associated lipodystrophy reducing visceral adipose tissue. This peptide or oligopeptide is studied for its biological activity,...

Peptide Drugs intermediate

Testosterone Hormone: Endogenous Peptide Hormone Reference

Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Testosterone Peptide Hormone: Comprehensive Peptide Refer...

Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Testosterone Protein Hormone: Comprehensive Peptide Refer...

Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...

Peptide Hormones intermediate

Tetanus Toxin (TeNT): Peptide Toxin in Pharmacology Refer...

Tetanus Toxin (TeNT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Tetrabody System 1: Oligopeptide Research Reference

A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Tetrabody System 2: Oligopeptide Research Reference

A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Tetrabody System 3: Oligopeptide Research Reference

A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...

Drug Delivery Systems advanced

Tetrabody: Oligopeptide Research Reference

Comprehensive reference for tetrabody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Tetradecyl Aminobutyroylvalylaminobutyric Urea Trifluoroa...

Comprehensive reference for Tetradecyl Aminobutyroylvalylaminobutyric Urea Trifluoroa..., a peptide compound with applications in research and therapeutics.

Cosmetic Peptides intermediate

Tetrahymena thermiphila: Oligopeptide Research Reference

Mucocyst discharge, antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Protist Peptides intermediate

Tetrahymena thermophila: Oligopeptide Research Reference

Binds surface receptor during mating. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Protist Peptides intermediate

Tetrazine Purification: Analytical Technique in Peptide R...

A purification technique for separating and isolating peptides using Tetrazine. This analytical technique provides valuable insights into peptide structure, ...

Purification Methods advanced

Tetrodotoxin (TTX): Peptide Toxin in Pharmacology Reference

Tetrodotoxin (TTX), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

Tetrodotoxin Analogs: Oligopeptide Research Reference

Tetrodotoxin Analogs, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

TEV Cleavage Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using TEV Cleavage. This analytical technique provides valuable insights into peptide structur...

Purification Methods advanced

Textilotoxin: Peptide Toxin in Pharmacology Reference

Textilotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

TGF Beta 1 Hormone: Endogenous Peptide Hormone Reference

TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 1 Peptide Hormone: Comprehensive Peptide Reference

TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 1 Protein Hormone: Comprehensive Peptide Reference

TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 1: Endogenous Peptide Hormone Reference

TGF-beta-1 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

TGF Beta 2 Hormone: Endogenous Peptide Hormone Reference

TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 2 Peptide Hormone: Comprehensive Peptide Reference

TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 2 Protein Hormone: Comprehensive Peptide Reference

TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 2: Endogenous Peptide Hormone Reference

TGF-beta-2 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

TGF Beta 3 Hormone: Endogenous Peptide Hormone Reference

TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 3 Peptide Hormone: Comprehensive Peptide Reference

TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 3 Protein Hormone: Comprehensive Peptide Reference

TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

TGF Beta 3: Endogenous Peptide Hormone Reference

TGF-beta-3 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

TGF Beta 5: Endogenous Peptide Hormone Reference

TGF-beta-5 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.

Peptide Hormones intermediate

TGF Beta Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting TGF Beta Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide-Drug Conjugates advanced

TGF-beta Pathway Peptide 1: Comprehensive Peptide Reference

A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

TGF-beta Pathway Peptide 2: Comprehensive Peptide Reference

A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

TGF-beta Pathway Peptide 3: Comprehensive Peptide Reference

A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

TGF-beta Pathway Peptide 4: Comprehensive Peptide Reference

A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

TGF-beta Pathway Peptide 5: Comprehensive Peptide Reference

A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Thaumatin: Oligopeptide Research Reference

thaumatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...

Agricultural Peptides intermediate

The Incretin Effect: Peptide Family Reference

Physiological phenomenon where oral glucose produces greater insulin secretion than intravenous glucose, mediated by GLP-1 and GIP.

GLP-1 Family beginner

Therapeutic Target Database (TTD)

Comprehensive reference for Therapeutic Target Database (TTD), a peptide compound with applications in research and therapeutics.

Peptide Databases intermediate

Therapeutic: Oligopeptide Research Reference

Therapeutic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activi...

Peptide Applications intermediate

Thermal Cleavable Purification

A purification technique for separating and isolating peptides using Thermal Cleavable. This analytical technique provides valuable insights into peptide str...

Purification Methods advanced

Thermo Q Exactive: Oligopeptide Research Reference

Orbitrap mass spectrometer for high-resolution peptide analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...

Peptide Therapeutics intermediate

Thermo Vanquish: Oligopeptide Research Reference

UHPLC system for high-speed peptide separation and analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...

Peptide Therapeutics intermediate

Thermodynamic Integration for Peptides

A computational method for studying peptides using Thermodynamic Integration. This analytical technique provides valuable insights into peptide structure, pu...

Computational Methods advanced

thermodynamics Resource: Oligopeptide Research Reference

The thermodynamics database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...

Databases & Resources intermediate

Thermosensitive Hydrogel: Oligopeptide Research Reference

Temperature-responsive hydrogels forming depot at body temperature for sustained release. This peptide or oligopeptide is studied for its biological activity...

Drug Delivery intermediate

Thick Film Synthesis: Analytical Technique in Peptide Res...

A peptide synthesis method using Thick Film for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...

Peptide Synthesis Methods advanced

Thin Film Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Thin Film for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Thioester Bonds in Peptides: Comprehensive Peptide Reference

Explore thioester bonds in peptide biosynthesis, including intein-mediated ligation. This modification affects peptide stability, receptor binding, and biolo...

Peptide Modifications advanced

Thiol Ene Synthesis: Analytical Technique in Peptide Rese...

A peptide synthesis method using Thiol Ene for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...

Peptide Synthesis Methods advanced

Thionin: Oligopeptide Research Reference

Thionin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Thioredoxin 1: Oligopeptide Research Reference

thioredoxin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Antioxidant Peptides intermediate

Thr6-bradykinin: Antimicrobial Peptide Reference

Thr6-bradykinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Threonine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Threonine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...

Amino Acid Metabolism intermediate

Threonine Modification: Post-Translational Modification R...

Post-translational modifications of Threonine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...

Amino Acid Modifications intermediate

Threonine Peptide: Oligopeptide Research Reference

Threonine (T) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...

Amino Acid Peptides beginner

Thrombin Cleavage Purification

A purification technique for separating and isolating peptides using Thrombin Cleavage. This analytical technique provides valuable insights into peptide str...

Purification Methods advanced

Thrombin Inhibitor: Enzyme in Peptide Biology Reference

thrombin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spec...

Enzyme Peptides intermediate

Thrombopoietin Hormone: Endogenous Peptide Hormone Reference

Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Thrombopoietin Peptide Hormone

Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Thrombopoietin Protein Hormone

Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...

Peptide Hormones intermediate

Thrombopoietin: Endogenous Peptide Hormone Reference

Glycoprotein hormone that stimulates megakaryocyte proliferation and platelet production through the c-Mpl receptor. Covers molecular mechanisms, biological ...

Hematopoietic Peptides intermediate

Thymopentin: Antimicrobial Peptide Reference

Synthetic pentapeptide from thymopoietin with T-cell stimulating activity. This antimicrobial peptide demonstrates activity against pathogens and is studied ...

Antimicrobial Peptides beginner

Thymosin Alpha-1: Antimicrobial Peptide Reference

Thymic peptide with immunomodulatory properties enhancing T-cell maturation. This antimicrobial peptide demonstrates activity against pathogens and is studie...

Antimicrobial Peptides intermediate

Thymosin alpha1: Structure, Function, and Significance

Thymosin alpha1 is a 28-amino acid peptide from thymus tissue that modulates immune function and is used as an immunotherapy agent.

Venom Peptides intermediate

Thyroid Cancer: Oligopeptide Research Reference

Malignant transformation of thyroid epithelium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...

Peptide Therapeutics intermediate

Thyrotropin-Releasing Hormone: Comprehensive Peptide Refe...

Tripeptide hypothalamic hormone stimulating TSH and prolactin release. This neuropeptide is involved in neurological signaling and is studied for its roles i...

Neuropeptides intermediate

Thyrotropin-Releasing Hormone: Comprehensive Peptide Refe...

A tripeptide (pGlu-His-Pro-NH₂) from the hypothalamus that initiates the thyroid axis by stimulating TSH and prolactin release from the anterior pituitary.

Peptide Hormones intermediate

Ticin: Structure, Function, and Significance

Ticin is a short antimicrobial peptide from horseshoe crab with disulfide-stabilized structure. This antimicrobial peptide demonstrates activity against path...

Antimicrobial Peptides intermediate

TIGIT Blocker: Oligopeptide Research Reference

TIGIT blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

Tildrakizumab: Oligopeptide Research Reference

tildrakizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Peptide Drugs intermediate

TIM 3 Blocker: Oligopeptide Research Reference

TIM 3 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Immune Peptides intermediate

time-to-progression Resource: Comprehensive Peptide Refer...

The time-to-progression database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

time-to-response Resource: Comprehensive Peptide Reference

The time-to-response database or resource for peptide research, providing data on structure, function, and interactions.

Databases & Resources intermediate

Tirzepatide - First-in-Human (NCT03142936)

First-in-human trial of tirzepatide for type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...

Peptide Therapeutics intermediate

Tirzepatide - SURMOUNT-1 (NCT04184622)

SURMOUNT-1 trial of tirzepatide for obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

Tirzepatide development, glucagon receptor biology

Tirzepatide development, glucagon receptor biology is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Tirzepatide Mounjaro and Zepbound

Dual GIP/GLP-1 receptor agonist approved for both type 2 diabetes (Mounjaro) and obesity (Zepbound) with superior metabolic effects.

GLP-1 Family advanced

Tirzepatide: Oligopeptide Research Reference

Dual GIP/GLP-1 receptor agonist with C-20 fatty diacid for once-weekly dosing. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Drugs advanced

Tisotumab Vedotin: Oligopeptide Research Reference

Tisotumab Vedotin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Synthetic Peptides intermediate

Tityustoxin Kv1.3: Peptide Toxin in Pharmacology Reference

Scorpion toxin selectively blocking Kv1.3 potassium channel for immunomodulation. This peptide toxin is derived from venom and studied for its pharmacologica...

Venom Peptides intermediate

TLR Agonist Conjugates: Oligopeptide Research Reference

TLR Agonist Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

TM-align Resource: Oligopeptide Research Reference

The TM-align database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

TM-score Resource: Oligopeptide Research Reference

The TM-score database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

TNF Alpha Hormone: Endogenous Peptide Hormone Reference

TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

TNF Alpha Peptide Hormone: Comprehensive Peptide Reference

TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

TNF Alpha Protein Hormone: Comprehensive Peptide Reference

TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...

Peptide Hormones intermediate

TNF Beta Hormone: Endogenous Peptide Hormone Reference

TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

TNF Beta Peptide Hormone: Endogenous Peptide Hormone Refe...

TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

TNF Beta Protein Hormone: Endogenous Peptide Hormone Refe...

TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

TNF Binding Protein: Oligopeptide Research Reference

TNF binding protein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Anti-inflammatory Peptides intermediate

TNF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting TNF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

TNF-alpha (Tumor Necrosis Factor Alpha)

Comprehensive reference for TNF-alpha (Tumor Necrosis Factor Alpha), a peptide compound with applications in research and therapeutics.

Biomarkers Expanded intermediate

Tocilizumab: Oligopeptide Research Reference

tocilizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

ToF SIMS Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using ToF SIMS. This analytical technique provides valuable insights into peptide structure, purity, and ...

Analytical Techniques advanced

Tokenization for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Tokenization. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Computational Methods advanced

Toll Like Receptor Agonist TLR1-agonist-1

Comprehensive reference for toll like receptor agonist TLR1-agonist-1, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR10-agonist-10

Comprehensive reference for toll like receptor agonist TLR10-agonist-10, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR11-agonist-11

Comprehensive reference for toll like receptor agonist TLR11-agonist-11, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR12-agonist-12

Comprehensive reference for toll like receptor agonist TLR12-agonist-12, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR13-agonist-13

Comprehensive reference for toll like receptor agonist TLR13-agonist-13, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR14-agonist-14

Comprehensive reference for toll like receptor agonist TLR14-agonist-14, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR15-agonist-15

Comprehensive reference for toll like receptor agonist TLR15-agonist-15, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR16-agonist-16

Comprehensive reference for toll like receptor agonist TLR16-agonist-16, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR17-agonist-17

Comprehensive reference for toll like receptor agonist TLR17-agonist-17, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR18-agonist-18

Comprehensive reference for toll like receptor agonist TLR18-agonist-18, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR19-agonist-19

Comprehensive reference for toll like receptor agonist TLR19-agonist-19, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR2-agonist-2

Comprehensive reference for toll like receptor agonist TLR2-agonist-2, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR20-agonist-20

Comprehensive reference for toll like receptor agonist TLR20-agonist-20, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR21-agonist-21

Comprehensive reference for toll like receptor agonist TLR21-agonist-21, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR22-agonist-22

Comprehensive reference for toll like receptor agonist TLR22-agonist-22, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR23-agonist-23

Comprehensive reference for toll like receptor agonist TLR23-agonist-23, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR24-agonist-24

Comprehensive reference for toll like receptor agonist TLR24-agonist-24, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR25-agonist-25

Comprehensive reference for toll like receptor agonist TLR25-agonist-25, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR26-agonist-26

Comprehensive reference for toll like receptor agonist TLR26-agonist-26, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR27-agonist-27

Comprehensive reference for toll like receptor agonist TLR27-agonist-27, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR28-agonist-28

Comprehensive reference for toll like receptor agonist TLR28-agonist-28, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR29-agonist-29

Comprehensive reference for toll like receptor agonist TLR29-agonist-29, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR3-agonist-3

Comprehensive reference for toll like receptor agonist TLR3-agonist-3, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR30-agonist-30

Comprehensive reference for toll like receptor agonist TLR30-agonist-30, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR31-agonist-31

Comprehensive reference for toll like receptor agonist TLR31-agonist-31, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR32-agonist-32

Comprehensive reference for toll like receptor agonist TLR32-agonist-32, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR33-agonist-33

Comprehensive reference for toll like receptor agonist TLR33-agonist-33, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR34-agonist-34

Comprehensive reference for toll like receptor agonist TLR34-agonist-34, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR35-agonist-35

Comprehensive reference for toll like receptor agonist TLR35-agonist-35, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR36-agonist-36

Comprehensive reference for toll like receptor agonist TLR36-agonist-36, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR37-agonist-37

Comprehensive reference for toll like receptor agonist TLR37-agonist-37, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR38-agonist-38

Comprehensive reference for toll like receptor agonist TLR38-agonist-38, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR39-agonist-39

Comprehensive reference for toll like receptor agonist TLR39-agonist-39, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR4-agonist-4

Comprehensive reference for toll like receptor agonist TLR4-agonist-4, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR40-agonist-40

Comprehensive reference for toll like receptor agonist TLR40-agonist-40, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR41-agonist-41

Comprehensive reference for toll like receptor agonist TLR41-agonist-41, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR42-agonist-42

Comprehensive reference for toll like receptor agonist TLR42-agonist-42, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR43-agonist-43

Comprehensive reference for toll like receptor agonist TLR43-agonist-43, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR44-agonist-44

Comprehensive reference for toll like receptor agonist TLR44-agonist-44, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR45-agonist-45

Comprehensive reference for toll like receptor agonist TLR45-agonist-45, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR46-agonist-46

Comprehensive reference for toll like receptor agonist TLR46-agonist-46, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR47-agonist-47

Comprehensive reference for toll like receptor agonist TLR47-agonist-47, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR48-agonist-48

Comprehensive reference for toll like receptor agonist TLR48-agonist-48, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR49-agonist-49

Comprehensive reference for toll like receptor agonist TLR49-agonist-49, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR5-agonist-5

Comprehensive reference for toll like receptor agonist TLR5-agonist-5, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR50-agonist-50

Comprehensive reference for toll like receptor agonist TLR50-agonist-50, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR6-agonist-6

Comprehensive reference for toll like receptor agonist TLR6-agonist-6, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR7-agonist-7

Comprehensive reference for toll like receptor agonist TLR7-agonist-7, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR8-agonist-8

Comprehensive reference for toll like receptor agonist TLR8-agonist-8, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Toll Like Receptor Agonist TLR9-agonist-9

Comprehensive reference for toll like receptor agonist TLR9-agonist-9, covering molecular structure, pharmacological properties, receptor interactions,

Immune Modulators intermediate

Tomato Peptide: Oligopeptide Research Reference

A bioactive peptide derived from tomato with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Tomato Tomatine: Oligopeptide Research Reference

tomato tomatine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Food-Derived Peptides intermediate

tomography for Peptides: Analytical Technique in Peptide ...

Application of tomography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...

Structural Biology Techniques advanced

Topoisomerase Inhibitor PDC: Comprehensive Peptide Reference

A peptide-drug conjugate targeting Topoisomerase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, ...

Peptide-Drug Conjugates advanced

Topoisomerase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Topoisomerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Total tau (t-tau): Oligopeptide Research Reference

Total tau (t-tau), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Biomarkers Expanded intermediate

Toxcin 1: Peptide Toxin in Pharmacology Reference

toxcin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

Toxcin 2: Peptide Toxin in Pharmacology Reference

toxcin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

toxicity Resource: Oligopeptide Research Reference

The toxicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...

Databases & Resources intermediate

Toxicity: Oligopeptide Research Reference

Organ damage (liver, kidney, heart, nerve, blood). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...

Peptide Safety intermediate

Toxoplasma SAG1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Toxoplasma SAG1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide Vaccines advanced

Toxoplasma SAG1: Oligopeptide Research Reference

Toxoplasma-SAG1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologica...

Peptide Vaccines intermediate

TP53 Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting TP53 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

TPO Hormone: Endogenous Peptide Hormone Reference

TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TPO Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting TPO Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

TPO Peptide Hormone: Endogenous Peptide Hormone Reference

TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TPO Protein Hormone: Endogenous Peptide Hormone Reference

TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TR FRET Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using TR FRET. This analytical technique provides valuable insights into peptide structure, purity, and c...

Analytical Techniques advanced

Trabectedin Marine Alkaloid: Comprehensive Peptide Reference

Tetrahydroisoquinoline alkaloid from marine tunicate Ecteinascidia turbinata for soft tissue sarcoma and ovarian cancer.

Anticancer Peptides advanced

Trabectedin: Oligopeptide Research Reference

Marine-derived tetrahydroisoquinoline alkaloid that binds DNA minor groove, used for soft tissue sarcoma and ovarian cancer.

Anticancer Peptides advanced

Trachynilin: Oligopeptide Research Reference

Trachynilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Tramadol Weak Opioid: Neuropeptide in Neuroscience Reference

Weak opioid agonist prodrug with serotonin-norepinephrine reuptake inhibition. This neuropeptide is involved in neurological signaling and is studied for its...

Neuropeptides beginner

Trans Cyclooctene Purification

A purification technique for separating and isolating peptides using Trans Cyclooctene. This analytical technique provides valuable insights into peptide str...

Purification Methods advanced

TransCon PTH: Oligopeptide Research Reference

Long-acting prodrug of PTH(1-34) using TransCon technology for continuous release. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Drugs advanced

Transcription factor: Oligopeptide Research Reference

Comprehensive reference for transcription factor, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Transdermal delivery: Oligopeptide Research Reference

Comprehensive reference for transdermal delivery, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Transdermal Patch Peptide: Comprehensive Peptide Reference

Transdermal delivery systems for peptide drugs through intact skin. This peptide or oligopeptide is studied for its biological activity, structure-activity r...

Drug Delivery intermediate

Transdermal Peptide Delivery: Comprehensive Peptide Refer...

Learn transdermal approaches for non-invasive peptide delivery across the skin barrier using chemical enhancers. Covers molecular mechanisms, biological acti...

Drug Delivery intermediate

Transdermal System 1: Oligopeptide Research Reference

A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Transdermal System 2: Oligopeptide Research Reference

A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Transdermal System 3: Oligopeptide Research Reference

A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...

Drug Delivery Systems advanced

Transferase PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Transferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Peptide-Drug Conjugates advanced

Transformer for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using Transformer. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

Transforming Growth Factor beta1-1-391

Comprehensive reference for transforming growth factor beta1-1-391, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta1-active-1-112

Comprehensive reference for transforming growth factor beta1-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta1-latent-1-391

Comprehensive reference for transforming growth factor beta1-latent-1-391, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta2-1-112

Comprehensive reference for transforming growth factor beta2-1-112, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta2-active-1-112

Comprehensive reference for transforming growth factor beta2-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta3-1-112

Comprehensive reference for transforming growth factor beta3-1-112, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transforming Growth Factor beta3-active-1-112

Comprehensive reference for transforming growth factor beta3-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Transition Path for Peptides: Comprehensive Peptide Refer...

A computational method for studying peptides using Transition Path. This analytical technique provides valuable insights into peptide structure, purity, and ...

Computational Methods advanced

Trastuzumab Deruxtecan: Oligopeptide Research Reference

Trastuzumab Deruxtecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Tremelimumab: Oligopeptide Research Reference

tremelimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Peptide Drugs intermediate

TRH (Thyrotropin-releasing hormone)

Comprehensive reference for TRH (Thyrotropin-releasing hormone), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

TRH 1-3: Peptide Fragment Reference

Comprehensive reference for TRH 1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

TRH Hormone: Endogenous Peptide Hormone Reference

TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TRH Peptide Hormone: Endogenous Peptide Hormone Reference

TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TRH Protein Hormone: Endogenous Peptide Hormone Reference

TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TRH: Antimicrobial Peptide Reference

TRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Amphibian Peptides intermediate

Triabody System 1: Oligopeptide Research Reference

A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Triabody System 2: Oligopeptide Research Reference

A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Triabody System 3: Oligopeptide Research Reference

A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...

Drug Delivery Systems advanced

Triabody: Oligopeptide Research Reference

Comprehensive reference for triabody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

Triazole Stapling (Click Chemistry)

Introduction of triazole cross-links using click chemistry. Stabilizes peptides. This peptide or oligopeptide is studied for its biological activity, structu...

Peptide Therapeutics intermediate

Trichocyst discharged as defensive filament

Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Protist Peptides intermediate

Tripeptide-9 Citrulline + Tripeptide-10 Citrulline

Comprehensive reference for Tripeptide-9 Citrulline + Tripeptide-10 Citrulline, a peptide compound with applications in research and therapeutics.

Cosmetic Peptides intermediate

Triptolide: Structure, Function, and Significance

Triptolide is a bioactive diterpenoid from thunder god vine with potent immunosuppressive and anti-inflammatory properties.

Venom Peptides intermediate

Triptorelin Pamoate: Oligopeptide Research Reference

Triptorelin Pamoate, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded intermediate

Triptorelin Sustained Release: Comprehensive Peptide Refe...

Long-acting triptorelin depot formulations for sustained GnRH receptor suppression in prostate cancer and central precocious puberty.

Therapeutic Peptides intermediate

Triptorelin: Oligopeptide Research Reference

triptorelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

Triptorelin: Oligopeptide Research Reference

Long-acting GnRH agonist with D-Trp substitution for profound gonadotropin suppression. This peptide or oligopeptide is studied for its biological activity, ...

Peptide Drugs intermediate

Tritrpticin: Antimicrobial Peptide Reference

Trp-rich AMP from bullfrog skin with broad-spectrum activity and low hemolysis. This antimicrobial peptide demonstrates activity against pathogens and is stu...

Antimicrobial Peptides intermediate

Triturin: Antimicrobial Peptide Reference

triturin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...

Antimicrobial Peptides intermediate

TrkB Agonist: Oligopeptide Research Reference

TrkB agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Neurological Peptides intermediate

TrkC Agonist: Oligopeptide Research Reference

TrkC agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Neurological Peptides intermediate

Troponin I: Oligopeptide Research Reference

Cardiac muscle protein. MI biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Therapeutics intermediate

Troponin T: Oligopeptide Research Reference

Cardiac muscle protein. MI biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Therapeutics intermediate

Trout NPY: Oligopeptide Research Reference

Trout NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

TrRosetta for Peptides: Analytical Technique in Peptide R...

A computational method for studying peptides using TrRosetta. This analytical technique provides valuable insights into peptide structure, purity, and charac...

Computational Methods advanced

Trypanosoma brucei: Oligopeptide Research Reference

Variable surface glycoprotein epitope switching. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Protist Peptides intermediate

Trypanosoma cruzi: Oligopeptide Research Reference

Transfers sialic acid to parasite surface. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Protist Peptides intermediate

Trypsin Inhibitor (Kunitz): Comprehensive Peptide Reference

Comprehensive reference for Trypsin Inhibitor (Kunitz), a peptide compound with applications in research and therapeutics.

Plant Peptides intermediate

Tryptophan Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Tryptophan including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...

Amino Acid Metabolism intermediate

Tryptophan Modification: Post-Translational Modification ...

Post-translational modifications of Tryptophan including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...

Amino Acid Modifications intermediate

Tryptophan Peptide: Oligopeptide Research Reference

Tryptophan (W) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...

Amino Acid Peptides beginner

Ts1 (Tityustoxin): Peptide Toxin in Pharmacology Reference

Ts1 (Tityustoxin), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

TSH Family Peptides: Endogenous Peptide Hormone Reference

Guide to thyroid-stimulating hormone family peptides and their regulation of thyroid function. This endogenous peptide hormone plays important roles in physi...

Peptide Families intermediate

TSH Hormone: Endogenous Peptide Hormone Reference

TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TSH Peptide Hormone: Endogenous Peptide Hormone Reference

TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

TSH Protein Hormone: Endogenous Peptide Hormone Reference

TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

Tube Assembly System 1: Oligopeptide Research Reference

A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Tube Assembly System 2: Oligopeptide Research Reference

A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Tube Assembly System 3: Oligopeptide Research Reference

A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Tuberculosis Peptides: Oligopeptide Research Reference

Peptides associated with Tuberculosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...

Disease-Associated Peptides intermediate

Tuberculosis: Oligopeptide Research Reference

M. tuberculosis. Treatments: RIPE therapy (4 drugs, 6 months). This peptide or oligopeptide is studied for its biological activity, structure-activity relati...

Peptide Therapeutics intermediate

Tubulin Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Tubulin Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...

Peptide-Drug Conjugates advanced

Tubulin PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting Tubulin for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide-Drug Conjugates advanced

Tubulin polymer: Oligopeptide Research Reference

Comprehensive reference for tubulin polymer, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Tumor Marker AFP: Oligopeptide Research Reference

tumor marker AFP in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Diagnostic Peptides intermediate

Tumor Marker CA125: Oligopeptide Research Reference

tumor marker CA125 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Diagnostic Peptides intermediate

Tumor Marker CA19 9: Oligopeptide Research Reference

tumor marker CA19 9 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Diagnostic Peptides intermediate

Tumor Marker CEA: Oligopeptide Research Reference

tumor marker CEA in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Diagnostic Peptides intermediate

Tumor Marker HCG: Oligopeptide Research Reference

tumor marker HCG in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Diagnostic Peptides intermediate

Tumor Marker PSA: Oligopeptide Research Reference

tumor marker PSA in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Diagnostic Peptides intermediate

Tumor Necrosis Factor LT-alpha-1-171

Comprehensive reference for tumor necrosis factor LT-alpha-1-171, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor LT-beta-1-171

Comprehensive reference for tumor necrosis factor LT-beta-1-171, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-alpha-1-100

Comprehensive reference for tumor necrosis factor TNF-alpha-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-alpha-1-150

Comprehensive reference for tumor necrosis factor TNF-alpha-1-150, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-alpha-1-233

Comprehensive reference for tumor necrosis factor TNF-alpha-1-233, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-alpha-1-50

Comprehensive reference for tumor necrosis factor TNF-alpha-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-beta-1-100

Comprehensive reference for tumor necrosis factor TNF-beta-1-100, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-beta-1-171

Comprehensive reference for tumor necrosis factor TNF-beta-1-171, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TNF-beta-1-50

Comprehensive reference for tumor necrosis factor TNF-beta-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TRAIL-1-114

Comprehensive reference for tumor necrosis factor TRAIL-1-114, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TRAIL-1-180

Comprehensive reference for tumor necrosis factor TRAIL-1-180, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TRAIL-1-281

Comprehensive reference for tumor necrosis factor TRAIL-1-281, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Tumor Necrosis Factor TRAIL-1-50

Comprehensive reference for tumor necrosis factor TRAIL-1-50, covering molecular structure, pharmacological properties, receptor interactions,

Cytokines intermediate

Turkey Beta-Defensin (TvBD): Comprehensive Peptide Reference

Comprehensive reference for Turkey Beta-Defensin (TvBD), a peptide compound with applications in research and therapeutics.

Antimicrobial Peptides intermediate

Turkey Cathelicidin: Oligopeptide Research Reference

Turkey Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Turkey Defensin: Oligopeptide Research Reference

Turkey Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Bird Peptides intermediate

Turmeric Peptide: Oligopeptide Research Reference

A bioactive peptide derived from turmeric with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...

Plant-Derived Peptides intermediate

Turn Assembly System 1: Oligopeptide Research Reference

A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Turn Assembly System 2: Oligopeptide Research Reference

A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Turn Assembly System 3: Oligopeptide Research Reference

A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...

Drug Delivery Systems advanced

Turtle Cathelicidin: Oligopeptide Research Reference

Turtle Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Turtle Defensin: Oligopeptide Research Reference

Turtle Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Turtle Peptides: Oligopeptide Research Reference

Antimicrobial, Biomineralization. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Reptile Peptides intermediate

Turtle Serum Peptides: Oligopeptide Research Reference

Turtle Serum Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

Turtle Shell Matrix Peptides: Comprehensive Peptide Refer...

Comprehensive reference for Turtle Shell Matrix Peptides, a peptide compound with applications in research and therapeutics.

Reptile Peptides intermediate

Tx3a: Peptide Toxin in Pharmacology Reference

Tx3a is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Tx3b: Peptide Toxin in Pharmacology Reference

Tx3b is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Tx3c: Peptide Toxin in Pharmacology Reference

Tx3c is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...

Venom Peptides intermediate

Tx4(4 7): Peptide Toxin in Pharmacology Reference

Tx4(4-7) is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its ph...

Venom Peptides intermediate

Type 1 Diabetes Mellitus: Oligopeptide Research Reference

Comprehensive reference for Type 1 Diabetes Mellitus, a peptide compound with applications in research and therapeutics.

Metabolic intermediate

Type 1 Diabetes: Oligopeptide Research Reference

Autoimmune β-cell destruction → absolute insulin deficiency. HLA-DR3/DR4 associated. Treatments: insulin replacement (basal-bolus), CGM, insulin pumps.

Peptide Therapeutics intermediate

Type 2 Diabetes: Oligopeptide Research Reference

Chronic metabolic disorder: insulin resistance + β-cell failure. Risk factors: obesity, inactivity, genetics. Complications: retinopathy, nephropathy, neurop...

Peptide Therapeutics intermediate

Type1 Diabetes Peptides: Oligopeptide Research Reference

Peptides associated with Type1 Diabetes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...

Disease-Associated Peptides intermediate

Tyrocidine A1: Antimicrobial Peptide Reference

tyrocidine-A1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Tyrocidine A2: Antimicrobial Peptide Reference

tyrocidine-A2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Tyrocidine A3: Antimicrobial Peptide Reference

tyrocidine-A3 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Tyrocidine B1: Antimicrobial Peptide Reference

tyrocidine-B1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Tyrocidine: Antimicrobial Peptide Reference

tyrocidine is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.

Antimicrobial Peptides intermediate

Tyrosine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Tyrosine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...

Amino Acid Metabolism intermediate

Tyrosine Modification: Post-Translational Modification Re...

Post-translational modifications of Tyrosine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...

Amino Acid Modifications intermediate

Tyrosine Peptide: Oligopeptide Research Reference

Tyrosine (Y) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...

Amino Acid Peptides beginner

Tyrothricin: Antimicrobial Peptide Reference

Mixture of gramicidins and tyrocidines from Bacillus brevis used as a topical antimicrobial for throat and skin infections.

Antimicrobial Peptides beginner

U Urealyticum Peptide: Oligopeptide Research Reference

A peptide associated with U Urealyticum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...

Microbial Peptides intermediate

U-50488: Neuropeptide in Neuroscience Reference

Potent selective kappa-opioid agonist with antinociceptive and diuretic effects. This neuropeptide is involved in neurological signaling and is studied for i...

Neuropeptides intermediate

U-69593: Neuropeptide in Neuroscience Reference

Selective kappa-opioid receptor agonist for pharmacological studies. This neuropeptide is involved in neurological signaling and is studied for its roles in ...

Neuropeptides intermediate

Ubiquitin → Proteasome (Degradation Signal)

Comprehensive reference for Ubiquitin → Proteasome (Degradation Signal), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Ubiquitin-proteasome system, 2004 Nobel Prize (Ciechanove...

Ubiquitin-proteasome system, 2004 Nobel Prize (Ciechanove... is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

Ubiquitination (Lys): Post-Translational Modification Ref...

Ubiquitination (Lys), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Modifications intermediate

Ubrogepant: Oligopeptide Research Reference

Oral CGRP receptor antagonist for acute migraine treatment providing pain freedom. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Drugs beginner

Uc Peptides: Oligopeptide Research Reference

Peptides associated with Uc including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological act...

Disease-Associated Peptides intermediate

UCSC Genome Browser: Oligopeptide Research Reference

Genome browser for visualizing genomic data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...

Peptide Therapeutics intermediate

UHPLC Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using UHPLC. This analytical technique provides valuable insights into peptide structure, purity, and cha...

Analytical Techniques advanced

Ulefipant: Oligopeptide Research Reference

NK1 receptor antagonist peptide under investigation for chemotherapy-induced nausea and vomiting. This peptide or oligopeptide is studied for its biological ...

Neurokinin Antagonists intermediate

Ultra-Rapid Insulin Lispro: Comprehensive Peptide Reference

Ultra-rapid insulin lispro formulation with treprostinil and citrate for accelerated initial absorption. This peptide or oligopeptide is studied for its biol...

Peptide Drugs intermediate

Ultrafiltration Purification: Comprehensive Peptide Refer...

A purification technique for separating and isolating peptides using Ultrafiltration. This analytical technique provides valuable insights into peptide struc...

Purification Methods advanced

Ultrasonic Synthesis: Analytical Technique in Peptide Res...

A peptide synthesis method using Ultrasonic for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...

Peptide Synthesis Methods advanced

UMAP for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using UMAP. This analytical technique provides valuable insights into peptide structure, purity, and characteriz...

Computational Methods advanced

Umbrella Sampling for Peptides

A computational method for studying peptides using Umbrella Sampling. This analytical technique provides valuable insights into peptide structure, purity, an...

Computational Methods advanced

UniProt Resource: Oligopeptide Research Reference

The UniProt database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...

Databases & Resources intermediate

UniProt: Oligopeptide Research Reference

Comprehensive resource for protein sequence and functional information. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Sequence intermediate

United Atom for Peptides: Analytical Technique in Peptide...

A computational method for studying peptides using United Atom. This analytical technique provides valuable insights into peptide structure, purity, and char...

Computational Methods advanced

UPLC Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using UPLC. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

Urinary Tract Infection: Oligopeptide Research Reference

Urinary Tract Infection, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Infectious intermediate

Urocortin: Neuropeptide in Neuroscience Reference

A 40-amino acid neuropeptide related to CRH that preferentially activates CRH-R2 receptors, mediating stress response, feeding, and cardiovascular function.

Neuropeptides intermediate

Urodilatin Hormone: Endogenous Peptide Hormone Reference

Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Urodilatin Peptide Hormone: Comprehensive Peptide Reference

Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Urodilatin Protein Hormone: Comprehensive Peptide Reference

Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...

Peptide Hormones intermediate

Urodilatin: Endogenous Peptide Hormone Reference

Urodilatin is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.

Peptide Hormones intermediate

Urodilatin: Oligopeptide Research Reference

urodilatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Cardiovascular Peptides intermediate

Urotensin II: Oligopeptide Research Reference

Cyclic 11-amino acid peptide that activates the UT receptor, considered the most potent mammalian vasoconstrictor. Covers molecular mechanisms, biological ac...

Cardiovascular Peptides advanced

UV Cleavable Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using UV Cleavable. This analytical technique provides valuable insights into peptide structur...

Purification Methods advanced

UV-Vis Spectroscopy for Peptides

Understand UV-Vis spectroscopy for peptide quantification, purity assessment, and conformational studies. This peptide or oligopeptide is studied for its bio...

Peptide Analysis beginner

UV1: Oligopeptide Research Reference

UV1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Vaccines intermediate

V Cholerae Peptide: Oligopeptide Research Reference

A peptide associated with V Cholerae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...

Microbial Peptides intermediate

V5 Tag Purification: Analytical Technique in Peptide Rese...

A purification technique for separating and isolating peptides using V5 Tag. This analytical technique provides valuable insights into peptide structure, pur...

Purification Methods advanced

Vaborbactam: Oligopeptide Research Reference

Boronic acid-based beta-lactamase inhibitor that targets KPC carbapenemases, restoring meropenem activity against resistant Enterobacterales.

Beta-Lactamase Inhibitors advanced

Vaccine Conjugates: Oligopeptide Research Reference

Vaccine Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Drug Conjugates intermediate

Vaginal Peptide Delivery: Oligopeptide Research Reference

Vaginal delivery systems for local and systemic peptide drug administration. This peptide or oligopeptide is studied for its biological activity, structure-a...

Drug Delivery intermediate

Valine Metabolism: Oligopeptide Research Reference

Metabolic pathways involving Valine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...

Amino Acid Metabolism intermediate

Valine Modification: Post-Translational Modification Refe...

Post-translational modifications of Valine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...

Amino Acid Modifications intermediate

Valine Peptide: Oligopeptide Research Reference

Valine (V) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...

Amino Acid Peptides beginner

Vancomycin - MRSA (NCT00000127)

Trial of vancomycin for MRSA infections. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...

Peptide Therapeutics intermediate

Vancomycin: Antimicrobial Peptide Reference

Vancomycin is a glycopeptide antibiotic from Amycolatopsis orientalis that inhibits cell wall synthesis in gram-positive bacteria, including MRSA.

Antimicrobial Peptides intermediate

Vapreotide: Oligopeptide Research Reference

Vapreotide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Analogs intermediate

Variational Autoencoder for Peptides

A computational method for studying peptides using Variational Autoencoder. This analytical technique provides valuable insights into peptide structure, puri...

Computational Methods advanced

Vascular Endothelial Growth Factor 121

Comprehensive reference for vascular endothelial growth factor 121, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Vascular Endothelial Growth Factor 145

Comprehensive reference for vascular endothelial growth factor 145, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Vascular Endothelial Growth Factor 165

Comprehensive reference for vascular endothelial growth factor 165, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Vascular Endothelial Growth Factor 189

Comprehensive reference for vascular endothelial growth factor 189, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Vascular Endothelial Growth Factor 206

Comprehensive reference for vascular endothelial growth factor 206, covering molecular structure, pharmacological properties, receptor interactions,

Growth Factors intermediate

Vascular Endothelial Growth Factor fragment-1-50

Comprehensive reference for vascular endothelial growth factor fragment-1-50, covering molecular structure, pharmacological properties,

Growth Factors intermediate

Vascular Endothelial Growth Factor fragment-100-165

Comprehensive reference for vascular endothelial growth factor fragment-100-165, covering molecular structure, pharmacological properties,

Growth Factors intermediate

Vascular Endothelial Growth Factor fragment-50-100

Comprehensive reference for vascular endothelial growth factor fragment-50-100, covering molecular structure, pharmacological properties,

Growth Factors intermediate

Vasculitis Peptides: Oligopeptide Research Reference

Peptides associated with Vasculitis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...

Disease-Associated Peptides intermediate

Vasoactive Intestinal Peptide (VIP)

Comprehensive reference for Vasoactive Intestinal Peptide (VIP), a peptide compound with applications in research and therapeutics.

Neuropeptides intermediate

Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...

28-amino acid neuropeptide that causes vasodilation, stimulates intestinal secretion, and has immunomodulatory properties.

Gastrointestinal Peptides intermediate

Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...

28-amino acid neuropeptide causing vasodilation and chloride secretion in intestine. This neuropeptide is involved in neurological signaling and is studied f...

Neuropeptides intermediate

Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...

A 28-amino acid neuropeptide with potent vasodilatory, secretory, and immunomodulatory effects, acting through VPAC1 and VPAC2 receptors throughout the body.

Neuropeptides intermediate

Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...

VIP is a 28-amino acid neuropeptide mediating vasodilation, secretion, and immune modulation through VPAC1 and VPAC2 receptors.

Neuropeptides intermediate

Vasopressin (AVP): Neuropeptide in Neuroscience Reference

Vasopressin (AVP), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Neuropeptides intermediate

Vasopressin → V1aR: Oligopeptide Research Reference

Vasopressin → V1aR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Vasopressin → V2R: Oligopeptide Research Reference

Vasopressin → V2R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Peptide Interactions intermediate

Vasopressin 1-5: Peptide Fragment Reference

Comprehensive reference for vasopressin 1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 1-6: Peptide Fragment Reference

Comprehensive reference for vasopressin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 1-7: Peptide Fragment Reference

Comprehensive reference for vasopressin 1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 1-8: Peptide Fragment Reference

Comprehensive reference for vasopressin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 1-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 2-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 2-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 3-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 3-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 4-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 4-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 5-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 5-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 6-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 6-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 7-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 7-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin 8-9: Peptide Fragment Reference

Comprehensive reference for vasopressin 8-9 variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin Central Effects: Comprehensive Peptide Reference

Neuropeptide effects on social behavior, aggression, and memory in CNS. This neuropeptide is involved in neurological signaling and is studied for its roles ...

Neuropeptides intermediate

Vasopressin desmopressin: Endogenous Peptide Hormone Refe...

Comprehensive reference for vasopressin desmopressin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin Family Peptides: Comprehensive Peptide Reference

Guide to vasopressin family peptides including AVP and their roles in water balance and blood pressure. This peptide or oligopeptide is studied for its biolo...

Peptide Families intermediate

Vasopressin felypressin: Endogenous Peptide Hormone Refer...

Comprehensive reference for vasopressin felypressin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin Hormone: Endogenous Peptide Hormone Reference

Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Vasopressin Intramolecular (Disulfide Bond)

Comprehensive reference for Vasopressin Intramolecular (Disulfide Bond), a peptide compound with applications in research and therapeutics.

Peptide Interactions intermediate

Vasopressin lypressin: Endogenous Peptide Hormone Reference

Comprehensive reference for vasopressin lypressin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin ornipressin: Endogenous Peptide Hormone Refer...

Comprehensive reference for vasopressin ornipressin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin Pair Bonding: Neuropeptide in Neuroscience Re...

Vasopressin V1a effects on male pair bonding and paternal behavior. This neuropeptide is involved in neurological signaling and is studied for its roles in b...

Neuropeptides intermediate

Vasopressin Peptide Hormone: Comprehensive Peptide Reference

Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Vasopressin Protein Hormone: Comprehensive Peptide Reference

Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...

Peptide Hormones intermediate

Vasopressin terlipressin: Endogenous Peptide Hormone Refe...

Comprehensive reference for vasopressin terlipressin variant, covering molecular structure, pharmacological properties, receptor interactions,

Peptide Hormones intermediate

Vasopressin V1 Agonist: Oligopeptide Research Reference

vasopressin V1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Cardiovascular Peptides intermediate

Vasopressin V2 Agonist: Oligopeptide Research Reference

vasopressin V2 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...

Cardiovascular Peptides intermediate

Vasopressin: Endogenous Peptide Hormone Reference

A 9-amino acid neuropeptide hormone from the posterior pituitary that regulates water balance, blood pressure, and social behavior, with clinical analogs inc...

Peptide Hormones intermediate

Vasopressin: Oligopeptide Research Reference

vasopressin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...

Peptide Drugs intermediate

VEGF A Hormone: Endogenous Peptide Hormone Reference

VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF A Peptide Hormone: Endogenous Peptide Hormone Reference

VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF A Protein Hormone: Endogenous Peptide Hormone Reference

VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF C Hormone: Endogenous Peptide Hormone Reference

VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF C Peptide Hormone: Endogenous Peptide Hormone Reference

VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF C Protein Hormone: Endogenous Peptide Hormone Reference

VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF D Hormone: Endogenous Peptide Hormone Reference

VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF D Peptide Hormone: Endogenous Peptide Hormone Reference

VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF D Protein Hormone: Endogenous Peptide Hormone Reference

VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...

Peptide Hormones intermediate

VEGF Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting VEGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...

Peptide-Drug Conjugates advanced

VEGFR Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting VEGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...

Peptide-Drug Conjugates advanced

VEGFR Inhibitor: Oligopeptide Research Reference

VEGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...

Signaling Peptides intermediate

Venom AMP Cross-Function: Antimicrobial Peptide Reference

Antimicrobial properties of animal venom peptides beyond toxic functions. This antimicrobial peptide demonstrates activity against pathogens and is studied f...

Antimicrobial Peptides intermediate

Venom Peptide / G-protein Activator

Venom Peptide / G-protein Activator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Insect Peptides intermediate

Venom Peptide / Growth Inhibitor

Venom Peptide / Growth Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...

Insect Peptides intermediate

Venom Peptide / Hypotensive: Comprehensive Peptide Reference

Venom Peptide / Hypotensive is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...

Insect Peptides intermediate

Venom Peptide / Mast Cell Activator

Venom Peptide / Mast Cell Activator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Insect Peptides intermediate

Venom Peptide / Membrane Disruption

Venom Peptide / Membrane Disruption is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...

Insect Peptides intermediate

Venom Peptide Drug Development

Clinical development of venom-derived peptides as therapeutic agents. This peptide toxin is derived from venom and studied for its pharmacological activity, ...

Venom Peptides intermediate

Venom Peptide Engineering: Comprehensive Peptide Reference

Rational modification of venom peptides for improved therapeutic properties. This peptide toxin is derived from venom and studied for its pharmacological act...

Venom Peptides advanced

Venom Peptide Evolution: Peptide Toxin in Pharmacology Re...

Evolutionary biology of venom peptide gene families. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of acti...

Venom Peptides advanced

Venom Peptide Formulation: Comprehensive Peptide Reference

Formulation strategies for venom peptide therapeutics including lyophilization. This peptide toxin is derived from venom and studied for its pharmacological ...

Venom Peptides intermediate

Venom Peptide Omics: Peptide Toxin in Pharmacology Reference

Proteomics and peptidomics approaches for venom peptide discovery. This peptide toxin is derived from venom and studied for its pharmacological activity, mec...

Venom Peptides advanced

Venom Peptide Pharmacokinetics

Pharmacokinetic properties of venom-derived therapeutic peptides. This peptide toxin is derived from venom and studied for its pharmacological activity, mech...

Venom Peptides advanced

Venom Peptide Pharmacology: Comprehensive Peptide Reference

General pharmacology of venom peptides as ion channel and receptor modulators. This peptide toxin is derived from venom and studied for its pharmacological a...

Venom Peptides intermediate

Venom Peptide Safety Profile: Comprehensive Peptide Refer...

Safety considerations for venom peptide therapeutics in clinical development. This peptide toxin is derived from venom and studied for its pharmacological ac...

Venom Peptides intermediate

Venom Peptide Selectivity: Comprehensive Peptide Reference

Structural basis for venom peptide selectivity for biological targets. This peptide toxin is derived from venom and studied for its pharmacological activity,...

Venom Peptides advanced

Venom Peptide Stability: Peptide Toxin in Pharmacology Re...

Strategies for improving venom peptide stability and bioavailability. This peptide toxin is derived from venom and studied for its pharmacological activity, ...

Venom Peptides advanced

Venom Peptides: Oligopeptide Research Reference

Neurotoxic, cytotoxic, antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Insect Peptides intermediate

Vesicle Assembly System 1: Comprehensive Peptide Reference

A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Vesicle Assembly System 2: Comprehensive Peptide Reference

A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Vesicle Assembly System 3: Comprehensive Peptide Reference

A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...

Drug Delivery Systems advanced

Vestronidase Alfa: Oligopeptide Research Reference

Vestronidase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

VHH antibody: Oligopeptide Research Reference

Comprehensive reference for vhh antibody, covering molecular structure, pharmacological properties, receptor interactions,

Drug Delivery intermediate

VHL Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting VHL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Vicilin: Oligopeptide Research Reference

Vicilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Viltolarsen: Oligopeptide Research Reference

Viltolarsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Vimentin intermediate filament

Comprehensive reference for vimentin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,

Structural Biology intermediate

Vinpocetine: Endogenous Peptide Hormone Reference

vinpocetine is an analog or modulator of oxytocin signaling used in obstetric and other clinical applications. This peptide or oligopeptide is studied for it...

Peptide Hormones intermediate

Vinyl Sulfone Purification: Comprehensive Peptide Reference

A purification technique for separating and isolating peptides using Vinyl Sulfone. This analytical technique provides valuable insights into peptide structu...

Purification Methods advanced

Violacein: Oligopeptide Research Reference

violacein is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...

Plant Peptides intermediate

Violacin A: Oligopeptide Research Reference

violacin-A is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...

Plant Peptides intermediate

Violacin B: Oligopeptide Research Reference

violacin-B is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...

Plant Peptides intermediate

VIP 1-12: Peptide Fragment Reference

Comprehensive reference for VIP 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 1-18: Peptide Fragment Reference

Comprehensive reference for VIP 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 1-22: Peptide Fragment Reference

Comprehensive reference for VIP 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 1-25: Peptide Fragment Reference

Comprehensive reference for VIP 1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 1-28: Peptide Fragment Reference

Comprehensive reference for VIP 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 10-28: Peptide Fragment Reference

Comprehensive reference for VIP 10-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 13-28: Peptide Fragment Reference

Comprehensive reference for VIP 13-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 16-28: Peptide Fragment Reference

Comprehensive reference for VIP 16-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 18-28: Peptide Fragment Reference

Comprehensive reference for VIP 18-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 21-28: Peptide Fragment Reference

Comprehensive reference for VIP 21-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 22-28: Peptide Fragment Reference

Comprehensive reference for VIP 22-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 25-28: Peptide Fragment Reference

Comprehensive reference for VIP 25-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP 7-28: Peptide Fragment Reference

Comprehensive reference for VIP 7-28 variant, covering molecular structure, pharmacological properties, receptor interactions,

Neuropeptides intermediate

VIP Family Peptides: Oligopeptide Research Reference

Learn about vasoactive intestinal peptide and related peptides in vasodilation and immune regulation. This peptide or oligopeptide is studied for its biologi...

Peptide Families intermediate

VIP Fragment: Oligopeptide Research Reference

VIP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Anti-inflammatory Peptides intermediate

VIP Hormone: Endogenous Peptide Hormone Reference

VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

VIP Peptide Hormone: Endogenous Peptide Hormone Reference

VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

VIP Protein Hormone: Endogenous Peptide Hormone Reference

VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...

Peptide Hormones intermediate

VIP/Secretin family: Neuropeptide in Neuroscience Reference

VIP/Secretin family is a bioactive compound with applications in peptide research and therapeutics. This neuropeptide is involved in neurological signaling a...

Neuropeptides intermediate

Virotoxins: Oligopeptide Research Reference

Virotoxins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Viscumin: Oligopeptide Research Reference

Viscumin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Plant Peptides intermediate

Visfatin Hormone: Endogenous Peptide Hormone Reference

Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Visfatin Peptide Hormone: Endogenous Peptide Hormone Refe...

Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Visfatin Protein Hormone: Endogenous Peptide Hormone Refe...

Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...

Peptide Hormones intermediate

Vitamin D (25-OH): Oligopeptide Research Reference

25-hydroxyvitamin D. Vitamin D status marker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...

Peptide Therapeutics intermediate

VMD: Oligopeptide Research Reference

Visual Molecular Dynamics software for molecular visualization and analysis. This peptide or oligopeptide is studied for its biological activity, structure-a...

Peptide Therapeutics intermediate

VPP: Oligopeptide Research Reference

Valine-proline-proline. ACE-inhibitory tripeptide from milk. Contributes to antihypertensive effects of dairy. This peptide or oligopeptide is studied for it...

Peptide Therapeutics intermediate

VSTx1: Peptide Toxin in Pharmacology Reference

VSTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...

Venom Peptides intermediate

Walnut Peptide: Oligopeptide Research Reference

A bioactive peptide derived from walnut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Plant-Derived Peptides intermediate

Wasp Venom AMPs: Peptide Toxin in Pharmacology Reference

AMPs from wasp venom providing innate defense and prey immobilization. This peptide toxin is derived from venom and studied for its pharmacological activity,...

Venom Peptides intermediate

Wasp Venom Antimicrobial: Peptide Toxin in Pharmacology R...

Antimicrobial properties of wasp venom peptides for infectious disease. This peptide toxin is derived from venom and studied for its pharmacological activity...

Venom Peptides intermediate

Wasp Venom Bioactive Peptides: Comprehensive Peptide Refe...

Discovery and characterization of bioactive peptides from wasp venoms. This peptide toxin is derived from venom and studied for its pharmacological activity,...

Venom Peptides intermediate

Wasp Venom Brachykinin: Peptide Toxin in Pharmacology Ref...

Kinins from wasp venom causing pain and vasodilation. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of act...

Venom Peptides intermediate

Wasp Venom Cancer Targets: Comprehensive Peptide Reference

Molecular targets of wasp venom peptides in cancer cells. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of...

Venom Peptides intermediate

Wasp Venom Phospholipase: Peptide Toxin in Pharmacology R...

Phospholipase enzymes from wasp venom contributing to tissue damage. This peptide toxin is derived from venom and studied for its pharmacological activity, m...

Venom Peptides intermediate

Wasp Venom Polybia-CP: Peptide Toxin in Pharmacology Refe...

Antimicrobial peptide from Polybia wasp venom with broad-spectrum activity. This peptide toxin is derived from venom and studied for its pharmacological acti...

Venom Peptides intermediate

Wasp Venom Polybia-MP1: Peptide Toxin in Pharmacology Ref...

Membrane-disrupting peptide from Polybia paulista wasp venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanis...

Venom Peptides intermediate

Watermelon Peptide: Oligopeptide Research Reference

A bioactive peptide derived from watermelon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...

Plant-Derived Peptides intermediate

Waters Xevo G2-XS QTof: Oligopeptide Research Reference

Quadrupole time-of-flight mass spectrometer for peptide identification. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Therapeutics intermediate

Well Tempered for Peptides: Comprehensive Peptide Reference

A computational method for studying peptides using Well Tempered. This analytical technique provides valuable insights into peptide structure, purity, and ch...

Computational Methods advanced

Western Blot Analysis: Analytical Technique in Peptide Re...

An analytical technique for characterizing peptides using Western Blot. This analytical technique provides valuable insights into peptide structure, purity, ...

Analytical Techniques advanced

Western Blot for Peptides: Comprehensive Peptide Reference

Understand western blotting techniques for detecting and semi-quantifying peptides using gel electrophoresis and immunodetection.

Peptide Analysis intermediate

WF11899A: Oligopeptide Research Reference

WF11899A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fungal Peptides intermediate

Wheat Gluten Exorphin: Oligopeptide Research Reference

wheat gluten exorphin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...

Food-Derived Peptides intermediate

Wheat Peptide: Oligopeptide Research Reference

A bioactive peptide derived from wheat with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...

Plant-Derived Peptides intermediate

Whitewater Arroyo N Vaccine: Comprehensive Peptide Reference

A peptide vaccine targeting Whitewater Arroyo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, struc...

Peptide Vaccines advanced

WHO ICTRP: Oligopeptide Research Reference

WHO International Clinical Trials Registry Platform. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...

Peptide Therapeutics intermediate

WHO Prequalification for Peptides

Understand WHO prequalification program requirements for peptide medicines in global health markets. This peptide or oligopeptide is studied for its biologic...

Regulatory advanced

Wickerhamomyces anomalus: Oligopeptide Research Reference

Binds β-1,3-glucan, disrupts cell wall. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Yeast Peptides intermediate

WNT Inhibitor PDC: Oligopeptide Research Reference

A peptide-drug conjugate targeting WNT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...

Peptide-Drug Conjugates advanced

Wnt Modulator: Oligopeptide Research Reference

Wnt modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...

Signaling Peptides intermediate

Wnt Pathway Peptide 1: Oligopeptide Research Reference

A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Wnt Pathway Peptide 2: Oligopeptide Research Reference

A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Wnt Pathway Peptide 3: Oligopeptide Research Reference

A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Wnt Pathway Peptide 4: Oligopeptide Research Reference

A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Wnt Pathway Peptide 5: Oligopeptide Research Reference

A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.

Signal Transduction Peptides advanced

Word2vec for Peptides: Analytical Technique in Peptide Re...

A computational method for studying peptides using Word2vec. This analytical technique provides valuable insights into peptide structure, purity, and charact...

Computational Methods advanced

Wound Healing AMPs: Antimicrobial Peptide Reference

Antimicrobial peptides contributing to wound healing through multiple mechanisms. This antimicrobial peptide demonstrates activity against pathogens and is s...

Antimicrobial Peptides intermediate

Wound Healing and Peptides: Comprehensive Peptide Reference

Learn about growth factor peptides and antimicrobial peptides that accelerate wound healing and tissue repair. This peptide or oligopeptide is studied for it...

Peptide Therapeutics intermediate

Wound Healing: Oligopeptide Research Reference

Peptide-based wound healing approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...

Peptide Therapeutics intermediate

Wound Infection: Oligopeptide Research Reference

Microbial contamination of wounds. Can delay healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...

Peptide Therapeutics intermediate

X Ray Crystal Analysis: Analytical Technique in Peptide R...

An analytical technique for characterizing peptides using X Ray Crystal. This analytical technique provides valuable insights into peptide structure, purity,...

Analytical Techniques advanced

X-ray Crystallography for Peptides

Understand X-ray crystallography methods for resolving atomic-level peptide structures from crystalline samples. Covers molecular mechanisms, biological acti...

Peptide Analysis advanced

X-ray crystallography techniques, protein folding studies

X-ray crystallography techniques, protein folding studies is a bioactive compound with applications in peptide research and therapeutics.

Peptide History intermediate

X-ray Crystallography: Analytical Technique in Peptide Re...

>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...

Peptide Analysis intermediate

X-ray for Peptides: Analytical Technique in Peptide Research

Application of X-ray technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biologi...

Structural Biology Techniques advanced

Xenopins: Antimicrobial Peptide Reference

xenopins is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...

Antimicrobial Peptides intermediate

xerogel for Peptides: Analytical Technique in Peptide Res...

Application of xerogel technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...

Structural Biology Techniques advanced

XLNet for Peptides: Analytical Technique in Peptide Research

A computational method for studying peptides using XLNet. This analytical technique provides valuable insights into peptide structure, purity, and characteri...

Computational Methods advanced

Xultophy Degludec-Liraglutide: Comprehensive Peptide Refe...

Fixed-ratio combination of insulin degludec and GLP-1 agonist liraglutide for once-daily injection. This peptide or oligopeptide is studied for its biologica...

Peptide Drugs intermediate

Y Pestis Peptide: Oligopeptide Research Reference

A peptide associated with Y Pestis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...

Microbial Peptides intermediate

YouTube Peptide Synthesis: Comprehensive Peptide Reference

Educational video resource on peptide synthesis techniques. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...

Peptide Therapeutics intermediate

YP-001: Oligopeptide Research Reference

YIIKGVFWDPAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Yeast Peptides intermediate

YP-003: Oligopeptide Research Reference

WHWLQLKPGQPMY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Yeast Peptides intermediate

YP-005: Oligopeptide Research Reference

MKFFSAALTLAAAVAG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Yeast Peptides intermediate

YP-007: Oligopeptide Research Reference

YIIKGVFWDPAC-Far. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Yeast Peptides intermediate

YP-009: Oligopeptide Research Reference

WHWLQLKPGQPMD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Yeast Peptides intermediate

YP-011: Oligopeptide Research Reference

AKIGLGYAQKIVNRAQKYKRQIGGPNFNKLCQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Yeast Peptides intermediate

YP-013: Oligopeptide Research Reference

ISNGLNGCQFANKGQYYCTCK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Yeast Peptides intermediate

YP-015: Oligopeptide Research Reference

ANLCNLCKNKGQYYCQCK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...

Yeast Peptides intermediate

YP-017: Oligopeptide Research Reference

NLCGKCKNKSGYYCTC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Yeast Peptides intermediate

YP-019: Oligopeptide Research Reference

CSWACKNKGQYYCQC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...

Yeast Peptides intermediate

YP-021: Oligopeptide Research Reference

DSHAKRHHGYKRKFHEKHHSHRGY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...

Yeast Peptides intermediate

YP-023: Oligopeptide Research Reference

KCNNGQYCNRGICFCQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...

Yeast Peptides intermediate

YP-025: Oligopeptide Research Reference

AGRGKQGGKVRAKAKTRSS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...

Yeast Peptides intermediate

YP-027: Oligopeptide Research Reference

LNQSNLPAISYD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...

Yeast Peptides intermediate

YP-029: Oligopeptide Research Reference

(2S,3R,4R,6E)-2-amino-3,4-dihydroxy-2-hydroxymethyl-14-oxo-6-eicosenoic acid derivative. This peptide or oligopeptide is studied for its biological activity,...

Yeast Peptides intermediate

YP-031: Oligopeptide Research Reference

MSAQNDKVDLDDDVAQD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...

Yeast Peptides intermediate

YP-033: Oligopeptide Research Reference

RFSFKKLSGSGFG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...

Yeast Peptides intermediate

YP-035: Oligopeptide Research Reference

AQNLNSFIKQYGDV. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...

Yeast Peptides intermediate

Zagotenemab: Oligopeptide Research Reference

Zagotenemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Therapeutic Peptides Expanded 2 intermediate

Zavegepant - First-in-Human (NCT02823622)

First-in-human trial of zavegepant for migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...

Peptide Therapeutics intermediate

Zavegepant - Migraine (NCT03872453)

Phase III trial of zavegepant for acute migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...

Peptide Therapeutics intermediate

Zavegepant: Oligopeptide Research Reference

Intranasal CGRP receptor antagonist for acute migraine with rapid onset via nasal absorption. This peptide or oligopeptide is studied for its biological acti...

Peptide Drugs beginner

Zebrafish NPY: Oligopeptide Research Reference

Zebrafish NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Fish Peptides intermediate

Zeta Analysis: Analytical Technique in Peptide Research

An analytical technique for characterizing peptides using Zeta. This analytical technique provides valuable insights into peptide structure, purity, and char...

Analytical Techniques advanced

zeta-potential for Peptides: Comprehensive Peptide Reference

Application of zeta-potential technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...

Structural Biology Techniques advanced

Ziconotide - Pain (NCT00000125)

Trial of ziconotide for chronic pain. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...

Peptide Therapeutics intermediate

Ziconotide: Oligopeptide Research Reference

Synthetic omega-conotoxin MVIIA that blocks N-type calcium channels in the spinal cord for severe chronic pain management.

Marine Peptides advanced

Ziconotide: Oligopeptide Research Reference

Ziconotide is a synthetic omega-conotoxin MVIIA peptide that blocks N-type calcium channels, approved for severe chronic pain via intrathecal delivery.

Therapeutic Peptides advanced

Zika E Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Zika E for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...

Peptide Vaccines advanced

Zika NS1 Vaccine: Oligopeptide Research Reference

A peptide vaccine targeting Zika NS1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...

Peptide Vaccines advanced

Zika Peptides: Oligopeptide Research Reference

Peptides associated with Zika including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...

Disease-Associated Peptides intermediate

Zinc Peptide: Oligopeptide Research Reference

zinc peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...

Antioxidant Peptides intermediate

Zinc-Binding Group Peptides: Comprehensive Peptide Reference

Peptides containing zinc-binding pharmacophores for metalloprotease inhibition including hydroxamates, carboxylates, and thiols.

Therapeutic Peptides advanced

Zoledronic Acid: Oligopeptide Research Reference

Nitrogen-containing bisphosphonate that inhibits farnesyl pyrophosphate synthase, used for osteoporosis and bone metastases.

Bone-Active Peptides intermediate

Zosuquidar: Oligopeptide Research Reference

zosuquidar in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...

Peptide Drugs intermediate

Zwitterionic guanidinium compound

Alexandrium tamarense. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...

Protist Peptides intermediate

α-Bungarotoxin: Peptide Toxin in Pharmacology Reference

α-Bungarotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

α-Cobrotoxin: Oligopeptide Research Reference

α-Cobrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Reptile Peptides intermediate

α-Conotoxin GI: Peptide Toxin in Pharmacology Reference

α-Conotoxin GI, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

α-Conotoxin MI: Peptide Toxin in Pharmacology Reference

α-Conotoxin MI, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

α-Conotoxin Vc1.1: Oligopeptide Research Reference

α-Conotoxin Vc1.1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

α-Lactorphin: Oligopeptide Research Reference

Opioid peptide derived from β-lactoglobulin. Found in milk. Has analgesic activity. This peptide or oligopeptide is studied for its biological activity, stru...

Peptide Therapeutics intermediate

α-Latrotoxin: Peptide Toxin in Pharmacology Reference

α-Latrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

δ-Conotoxin SVIA: Peptide Toxin in Pharmacology Reference

δ-Conotoxin SVIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

δ-Palutoxins (δ-PalUTx-1, -2, -3, -4)

Comprehensive reference for δ-Palutoxins (δ-PalUTx-1, -2, -3, -4), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

δ-Palutoxins: Peptide Toxin in Pharmacology Reference

δ-Palutoxins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

κ-Conotoxin PVIIA: Peptide Toxin in Pharmacology Reference

κ-Conotoxin PVIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

μ-Conotoxin GIIIA: Peptide Toxin in Pharmacology Reference

μ-Conotoxin GIIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

μ-Conotoxin KIIIA: Peptide Toxin in Pharmacology Reference

μ-Conotoxin KIIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

µg-mg: Oligopeptide Research Reference

Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...

Peptide Technologies intermediate

µg: Oligopeptide Research Reference

Low. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research...

Peptide Technologies intermediate

χ-Conotoxin MrIA: Oligopeptide Research Reference

χ-Conotoxin MrIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate

ω-Agatoxin IVA: Peptide Toxin in Pharmacology Reference

ω-Agatoxin IVA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

ω-Agatoxin TK: Peptide Toxin in Pharmacology Reference

ω-Agatoxin TK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Venom Peptides intermediate

ω-Conotoxin GVIA: Peptide Toxin in Pharmacology Reference

ω-Conotoxin GVIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Toxin Peptides intermediate

ω-Conotoxin MVIIA (Ziconotide)

Comprehensive reference for ω-Conotoxin MVIIA (Ziconotide), a peptide compound with applications in research and therapeutics.

Toxin Peptides intermediate

ω-Conotoxin: Oligopeptide Research Reference

ω-Conotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development

Marine Peptides intermediate