Oligopeptide Database
6517 peptides
17 OH Progesterone Hormone: Comprehensive Peptide Reference
17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...
17 OH Progesterone Peptide Hormone
17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...
17 OH Progesterone Protein Hormone
17 OH Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and ...
2-Aminoethoxy: Oligopeptide Research Reference
Comprehensive reference for 2-aminoethoxy, covering molecular structure, pharmacological properties, receptor interactions,
2-Fluoro RNA: Oligopeptide Research Reference
Comprehensive reference for 2-fluoro rna, covering molecular structure, pharmacological properties, receptor interactions,
2-O-methyl RNA: Oligopeptide Research Reference
Comprehensive reference for 2-o-methyl rna, covering molecular structure, pharmacological properties, receptor interactions,
2D PAGE Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using 2D PAGE. This analytical technique provides valuable insights into peptide structure, purity, and c...
3D Printing Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using 3D Printing for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
3D-Printed Peptide Delivery: Comprehensive Peptide Reference
Explore additive manufacturing of personalized peptide drug delivery devices with complex release profiles. This peptide or oligopeptide is studied for its b...
3D-printing for Peptides: Analytical Technique in Peptide...
Application of 3D-printing technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...
4 1BB Agonist: Oligopeptide Research Reference
4 1BB agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
A Baumannii Peptide: Oligopeptide Research Reference
A peptide associated with A Baumannii for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
A Baumannii Xdr Peptide: Oligopeptide Research Reference
A peptide associated with A Baumannii Xdr for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...
AAPPTec Apex: Oligopeptide Research Reference
Advanced automated peptide synthesizer for solid-phase peptide synthesis with high-throughput capabilities. This peptide or oligopeptide is studied for its b...
Ab Initio for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using Ab Initio. This analytical technique provides valuable insights into peptide structure, purity, and charac...
Abaloparatide SC: Oligopeptide Research Reference
PTHrP(1-34) analog for postmenopausal osteoporosis with preferential PTH1R anabolic activation. This peptide or oligopeptide is studied for its biological ac...
Abaloparatide: Oligopeptide Research Reference
Synthetic PTHrP analog that preferentially activates RG signaling for osteoporosis treatment with less hypercalcemia than teriparatide.
Abaloparatide: Oligopeptide Research Reference
Synthetic analog of PTHrP(1-34) used for osteoporosis treatment, promotes bone formation via PTH1R activation. This peptide or oligopeptide is studied for it...
Abatacept: Oligopeptide Research Reference
abatacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
AbbVie: Therapeutic Peptide Drug Profile
Global biopharmaceutical company specializing in immunology, oncology, and neuroscience peptide therapeutics including leuprolide.
Abciximab: Oligopeptide Research Reference
abciximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
ABL Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting ABL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Abrin: Peptide Toxin in Pharmacology Reference
Abrin is a highly toxic ribosome-inactivating protein from jequirity beans (Abrus precatorius) that inhibits protein synthesis, closely related to ricin in s...
accuracy Resource: Oligopeptide Research Reference
The accuracy database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
ACE Inhibitor: Enzyme in Peptide Biology Reference
ACE inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifici...
Ace-AMP1: Oligopeptide Research Reference
Ace-AMP1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ACE-Inhibitory Peptides (General)
Comprehensive reference for ACE-Inhibitory Peptides (General), a peptide compound with applications in research and therapeutics.
Acetone Precipitation Purification
A purification technique for separating and isolating peptides using Acetone Precipitation. This analytical technique provides valuable insights into peptide...
Acetyl Carnosine: Oligopeptide Research Reference
acetyl-carnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Acetyl Hexapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-NH₂)
Comprehensive reference for Acetyl Hexapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-NH₂), a peptide compound with applications in research and therapeutics.
Acetyl Hexapeptide-3 (Argireline)
Comprehensive reference for Acetyl Hexapeptide-3 (Argireline), a peptide compound with applications in research and therapeutics.
Acetyl Octapeptide-3 (SNAP-8): Comprehensive Peptide Refe...
Comprehensive reference for Acetyl Octapeptide-3 (SNAP-8), a peptide compound with applications in research and therapeutics.
Acetylation (Lys): Post-Translational Modification Reference
Acetylation (Lys), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Acetyltransferase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Acetyltransferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...
Acid Labile Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Acid Labile. This analytical technique provides valuable insights into peptide structure...
Acidic MPLA2: Peptide Toxin in Pharmacology Reference
acidic-MPLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...
ACS Medicinal Chemistry: Oligopeptide Research Reference
American Chemical Society journal focused on medicinal chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, struct...
ACTH (Adrenocorticotropic hormone)
Comprehensive reference for ACTH (Adrenocorticotropic hormone), a peptide compound with applications in research and therapeutics.
ACTH 1-10: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-13: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-18: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-24: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-39: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 1-39 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-4: Adrenocorticotropic Hormone Fragment in Peptide...
Comprehensive reference for ACTH 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 1-8: Adrenocorticotropic Hormone Fragment in Peptide...
Comprehensive reference for ACTH 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 11-24: Adrenocorticotropic Hormone Fragment in Pepti...
Comprehensive reference for ACTH 11-24 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 18-39: Adrenocorticotropic Hormone Fragment in Pepti...
Comprehensive reference for ACTH 18-39 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 3-18: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 3-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 4-10: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 4-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH 7-18: Adrenocorticotropic Hormone Fragment in Peptid...
Comprehensive reference for ACTH 7-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
ACTH Family Peptides: Oligopeptide Research Reference
Guide to ACTH family peptides including ACTH, MSH, and lipotropin in adrenal and melanocortin signaling. This peptide or oligopeptide is studied for its biol...
ACTH Hormone: Endogenous Peptide Hormone Reference
ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
ACTH Peptide Hormone: Endogenous Peptide Hormone Reference
ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
ACTH Protein Hormone: Endogenous Peptide Hormone Reference
ACTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
Actin capping: Oligopeptide Research Reference
Comprehensive reference for actin capping, covering molecular structure, pharmacological properties, receptor interactions,
Actin crosslinking: Oligopeptide Research Reference
Comprehensive reference for actin crosslinking, covering molecular structure, pharmacological properties, receptor interactions,
Actin depolymerization: Oligopeptide Research Reference
Comprehensive reference for actin depolymerization, covering molecular structure, pharmacological properties, receptor interactions,
Actin filament: Oligopeptide Research Reference
Comprehensive reference for actin filament, covering molecular structure, pharmacological properties, receptor interactions,
Actin nucleation: Oligopeptide Research Reference
Comprehensive reference for actin nucleation, covering molecular structure, pharmacological properties, receptor interactions,
Actin polymerization: Oligopeptide Research Reference
Comprehensive reference for actin polymerization, covering molecular structure, pharmacological properties, receptor interactions,
Actin severing: Oligopeptide Research Reference
Comprehensive reference for actin severing, covering molecular structure, pharmacological properties, receptor interactions,
Activation: Oligopeptide Research Reference
Receptor/enzyme stimulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
Active: Oligopeptide Research Reference
Active is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...
Activin A Antagonist: Oligopeptide Research Reference
activin A antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Activin A: Endogenous Peptide Hormone Reference
activin-A is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Activin AB: Endogenous Peptide Hormone Reference
activin-AB is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Activin B: Endogenous Peptide Hormone Reference
activin-B is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Activin C: Endogenous Peptide Hormone Reference
activin-C is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Activin/TGF-β Trap: Oligopeptide Research Reference
Activin/TGF-β Trap is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological...
Adalimumab: Oligopeptide Research Reference
adalimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Adaptive Biasing for Peptides: Comprehensive Peptide Refe...
A computational method for studying peptides using Adaptive Biasing. This analytical technique provides valuable insights into peptide structure, purity, and...
ADDMADMSTLADDLAC: Oligopeptide Research Reference
Microcystis aeruginosa. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
Adhd Peptides: Oligopeptide Research Reference
Peptides associated with Adhd including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...
Adipokinetic Hormone: Oligopeptide Research Reference
Adipokinetic Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Adiponectin 1-20: Peptide Fragment Reference
Comprehensive reference for adiponectin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin 1-30: Peptide Fragment Reference
Comprehensive reference for adiponectin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin 1-40: Peptide Fragment Reference
Comprehensive reference for adiponectin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin full-length-1-244: Comprehensive Peptide Refe...
Comprehensive reference for adiponectin full-length-1-244 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin globular-1-150: Comprehensive Peptide Reference
Comprehensive reference for adiponectin globular-1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin globular-100-150: Comprehensive Peptide Refer...
Comprehensive reference for adiponectin globular-100-150 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin globular-120-150: Comprehensive Peptide Refer...
Comprehensive reference for adiponectin globular-120-150 variant, covering molecular structure, pharmacological properties, receptor interactions,
Adiponectin Hormone: Endogenous Peptide Hormone Reference
Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Adiponectin Peptide Hormone: Comprehensive Peptide Reference
Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Adiponectin Protein Hormone: Comprehensive Peptide Reference
Adiponectin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Adiponectin: Oligopeptide Research Reference
Adiponectin is a 244-amino acid adipokine that enhances insulin sensitivity, exerts anti-inflammatory effects, and protects against cardiovascular disease th...
Adrenomedullin 2: Neuropeptide in Neuroscience Reference
adrenomedullin-2 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its bi...
Adrenomedullin 22 52: Neuropeptide in Neuroscience Reference
adrenomedullin-22-52 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for it...
Adrenomedullin 22 52: Oligopeptide Research Reference
adrenomedullin 22 52 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Adrenomedullin Hormone: Endogenous Peptide Hormone Reference
Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Adrenomedullin Peptide Hormone
Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Adrenomedullin Protein Hormone
Adrenomedullin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Adrenomedullin: Oligopeptide Research Reference
52-amino acid vasodilator peptide with potent hypotensive, natriuretic, and cardioprotective properties. This peptide or oligopeptide is studied for its biol...
Aducanumab: Oligopeptide Research Reference
Aducanumab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Advanced Analytics in Peptide Drug Development
Application of advanced statistical and data analytics methods to peptide drug development. This peptide or oligopeptide is studied for its biological activi...
Advanced Modeling in Peptide Drug Development
Computational modeling approaches for predicting peptide drug properties. This peptide or oligopeptide is studied for its biological activity, structure-acti...
adverse-event Resource: Oligopeptide Research Reference
The adverse-event database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...
aerogel for Peptides: Analytical Technique in Peptide Res...
Application of aerogel technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...
Afamelanotide: Oligopeptide Research Reference
Synthetic alpha-MSH analog for erythropoietic protoporphyria promoting melanogenesis for photoprotection. This peptide or oligopeptide is studied for its bio...
Affinity Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using Affinity. This analytical technique provides valuable insights into peptide structure, purity, and ...
Affinity Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using Affinity. This analytical technique provides valuable insights into peptide structure, p...
Affinity Purification: Oligopeptide Research Reference
Affinity Purification, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
AFM for Peptide Imaging: Analytical Technique in Peptide ...
Explore atomic force microscopy for high-resolution imaging of peptide morphology and self-assembly on surfaces. Covers molecular mechanisms, biological acti...
AFM for Peptides: Analytical Technique in Peptide Research
Application of AFM technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...
AFM: Oligopeptide Research Reference
µg. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...
Agalsidase Beta: Oligopeptide Research Reference
Agalsidase Beta, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Agalsidase: Oligopeptide Research Reference
agalsidase in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Agilent 1260 Infinity II: Oligopeptide Research Reference
HPLC system for peptide analysis. Binary/quaternary pump, autosampler, DAD detector. This peptide or oligopeptide is studied for its biological activity, str...
Agilent 6545 Q-TOF: Oligopeptide Research Reference
Quadrupole time-of-flight mass spectrometer. High-resolution accurate mass for peptide identification. This peptide or oligopeptide is studied for its biolog...
Aging and Defensins: Antimicrobial Peptide Reference
Age-related changes in AMP expression contributing to increased infection in elderly. This antimicrobial peptide demonstrates activity against pathogens and ...
Aging and Peptides: Oligopeptide Research Reference
Explore anti-aging peptide therapies including thymic peptides, telomerase activators, and senolytic peptides. This peptide or oligopeptide is studied for it...
Agitoxin-2: Oligopeptide Research Reference
38-residue peptide from Leiurus quinquestriatus scorpion venom. Blocks voltage-gated potassium channels (Kv1.1, Kv1.2, Kv1.3).
Agouti-Related Peptide: Neuropeptide in Neuroscience Refe...
A 113-amino acid neuropeptide co-expressed with NPY in the arcuate nucleus that antagonizes melanocortin receptors (MC3R/MC4R), stimulating appetite and oppo...
Agricultural Peptide Market: Comprehensive Peptide Reference
Market analysis for agricultural peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Agricultural Peptides: Crop Protection and Growth Enhance...
Explore peptide-based biopesticides and plant growth regulators for sustainable agriculture. This peptide or oligopeptide is studied for its biological activ...
Agricultural: Oligopeptide Research Reference
Agricultural is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...
AI in Peptide Design: Oligopeptide Research Reference
How artificial intelligence is transforming peptide drug discovery and design optimization. This peptide or oligopeptide is studied for its biological activi...
AI in Peptide Drug Discovery: Comprehensive Peptide Refer...
Application of artificial intelligence and machine learning to accelerate peptide drug discovery, design, and optimization.
AI in Peptide Formulation Development
Application of artificial intelligence and machine learning to optimize peptide drug formulations. This peptide or oligopeptide is studied for its biological...
AI-Powered Peptide Design: Comprehensive Peptide Reference
Machine learning approaches including: generative models (VAE, GAN, diffusion), reinforcement learning for optimization, and deep learning for property predi...
Aids Peptides: Oligopeptide Research Reference
Peptides associated with Aids including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...
Airway Surface Liquid Peptides
Antimicrobial peptides in airway surface liquid protecting against respiratory infections. This antimicrobial peptide demonstrates activity against pathogens...
AKRHHGYKRKFHEKHHSHRGY: Oligopeptide Research Reference
Human salivary gland. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...
AKT Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting AKT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Alanine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Alanine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...
Alanine Modification: Post-Translational Modification Ref...
Post-translational modifications of Alanine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...
Alanine Peptide: Oligopeptide Research Reference
Alanine (A) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...
ALBERT for Peptides: Analytical Technique in Peptide Rese...
A computational method for studying peptides using ALBERT. This analytical technique provides valuable insights into peptide structure, purity, and character...
Albiglutide Albumin Fusion: Comprehensive Peptide Reference
Albumin-GLP-1 fusion protein providing once-weekly GLP-1 receptor agonism through non-covalent albumin binding. Covers molecular mechanisms, biological activ...
Albiglutide: Oligopeptide Research Reference
GLP-1 receptor agonist fused to human albumin for once-weekly type 2 diabetes treatment with reduced immunogenicity. Covers molecular mechanisms, biological ...
Albiglutide: Oligopeptide Research Reference
Once-weekly GLP-1 agonist fused to human albumin via non-cleavable linker for extended half-life. This peptide or oligopeptide is studied for its biological ...
Albiglutide: Oligopeptide Research Reference
albiglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Albumin Binding System 1: Oligopeptide Research Reference
A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Albumin Binding System 2: Oligopeptide Research Reference
A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Albumin Binding System 3: Oligopeptide Research Reference
A albumin-binding-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Albumin binding: Oligopeptide Research Reference
Comprehensive reference for albumin binding, covering molecular structure, pharmacological properties, receptor interactions,
Aldafermin: Oligopeptide Research Reference
Aldafermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Aldesleukin: Oligopeptide Research Reference
Recombinant interleukin-2 for metastatic renal cell carcinoma and melanoma, stimulating T-cell and NK cell proliferation.
Aldosterone Hormone: Endogenous Peptide Hormone Reference
Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Aldosterone Peptide Hormone: Comprehensive Peptide Reference
Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Aldosterone Protein Hormone: Comprehensive Peptide Reference
Aldosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Alefacept: Oligopeptide Research Reference
alefacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Alemtuzumab: Oligopeptide Research Reference
alemtuzumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Alexandrium catenella: Oligopeptide Research Reference
Blocks Na+ channel pore (site 1). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Alfentanil Short-Acting: Neuropeptide in Neuroscience Ref...
Short-acting synthetic opioid with faster onset than fentanyl. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Alfentanil: Oligopeptide Research Reference
Alfentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Aliskiren: Oligopeptide Research Reference
First direct renin inhibitor for hypertension, blocking the rate-limiting step of the renin-angiotensin-aldosterone system.
ALK Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting ALK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Alkyne Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using Alkyne. This analytical technique provides valuable insights into peptide structure, pur...
All Atom for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using All Atom. This analytical technique provides valuable insights into peptide structure, purity, and charact...
All except APD3 and WHO ICTRP: Comprehensive Peptide Refe...
Data Type. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...
All research peptides: Oligopeptide Research Reference
Strategy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...
Allatostatin: Oligopeptide Research Reference
Allatostatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Allatotropin: Oligopeptide Research Reference
Allatotropin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Allergy / Birch Pollen: Oligopeptide Research Reference
Allergy / Birch Pollen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Allergy / Grass Pollen: Oligopeptide Research Reference
Allergy / Grass Pollen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Almond Peptide: Oligopeptide Research Reference
A bioactive peptide derived from almond with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Alpha cobratoxin: Structure, Function, and Significance
Alpha-cobratoxin is a potent postsynaptic neurotoxin from cobra venom that blocks nicotinic acetylcholine receptors. Covers molecular mechanisms, biological ...
Alpha Conotoxin AuIB: Peptide Toxin in Pharmacology Refer...
alpha-conotoxin-AuIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Alpha Conotoxin GIIA: Peptide Toxin in Pharmacology Refer...
alpha-conotoxin-GIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Alpha Conotoxin ImI: Peptide Toxin in Pharmacology Reference
alpha-conotoxin-ImI is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolo...
Alpha Conotoxin PnIB: Peptide Toxin in Pharmacology Refer...
alpha-conotoxin-PnIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Alpha Conotoxin Vc1.1: Peptide Toxin in Pharmacology Refe...
alpha-conotoxin-Vc1.1 is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its bio...
Alpha Defensin 1: Antimicrobial Peptide Reference
alpha-defensin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Alpha Defensin 2: Antimicrobial Peptide Reference
alpha-defensin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Alpha Defensin 3: Antimicrobial Peptide Reference
alpha-defensin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Alpha Defensin 4: Antimicrobial Peptide Reference
alpha-defensin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Alpha MSH Fragment: Oligopeptide Research Reference
alpha MSH fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Alpha Synuclein: Oligopeptide Research Reference
alpha synuclein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Alpha-Bungarotoxin: Peptide Toxin in Pharmacology Reference
Alpha-bungarotoxin is a 74-amino acid three-finger neurotoxin from the banded krait snake that irreversibly blocks nicotinic acetylcholine receptors at the n...
Alpha-Calcitonin Gene-Related Peptide
Alpha-CGRP is a potent vasodilatory neuropeptide implicated in migraine pathophysiology and neurogenic inflammation through CLR/RAMP1 receptor signaling.
Alpha-Conotoxin GI: Peptide Toxin in Pharmacology Reference
Short disulfide-rich peptide from Conus geographus blocking nicotinic acetylcholine receptors. This peptide toxin is derived from venom and studied for its p...
Alpha-Conotoxin MI: Peptide Toxin in Pharmacology Reference
Muscle-type nicotinic receptor antagonist from Conus magus with therapeutic potential. This peptide toxin is derived from venom and studied for its pharmacol...
Alpha-Conotoxin PnIA: Peptide Toxin in Pharmacology Refer...
Neuronal nicotinic receptor antagonist from Conus pennaceus with analgesic potential. This peptide toxin is derived from venom and studied for its pharmacolo...
Alpha-Conotoxin Synthetic: Comprehensive Peptide Reference
Solid-phase synthesis strategies for conotoxin production. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...
Alpha-Defensin Oligomerization
Oligomerization forming pore-like structures in bacterial membranes. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...
Alpha-Endorphin: Neuropeptide in Neuroscience Reference
Shorter POMC-derived opioid with mu-opioid receptor activity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...
Alpha-Fetoprotein (AFP): Oligopeptide Research Reference
69 kDa glycoprotein, albumin superfamily. Produced by fetal liver and yolk sac. Binds estradiol, fatty acids. Normal adult: <10 ng/mL. HCC: >400 ng/mL (highl...
Alpha-MSH (α-MSH): Neuropeptide in Neuroscience Reference
Alpha-MSH (α-MSH), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alpha-MSH: Oligopeptide Research Reference
A 13-amino acid melanocortin peptide derived from proopiomelanocortin (POMC) that regulates pigmentation, appetite, and inflammation through melanocortin rec...
Alpha-Neo-Endorphin: Neuropeptide in Neuroscience Reference
Prodynorphin-derived opioid with kappa-opioid activity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...
Alpha-Synuclein (α-Syn): Oligopeptide Research Reference
Alpha-Synuclein (α-Syn), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alpha-synuclein Aggregation (Self-association)
Comprehensive reference for Alpha-synuclein Aggregation (Self-association), a peptide compound with applications in research and therapeutics.
Alpha-synuclein aggregation: Comprehensive Peptide Reference
Comprehensive reference for alpha-synuclein aggregation, covering molecular structure, pharmacological properties, receptor interactions,
Alpha-synuclein: Oligopeptide Research Reference
140-aa presynaptic protein. Aggregates in Parkinson's and Lewy body dementia. This peptide or oligopeptide is studied for its biological activity, structure-...
AlphaFold Applications: Oligopeptide Research Reference
Applications include: drug target identification, binding site prediction, enzyme engineering, antibody design, protein-protein interaction modeling, and und...
AlphaFold for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using AlphaFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...
AlphaFold for Peptides: Oligopeptide Research Reference
Applying DeepMind's AlphaFold to peptide structure prediction and drug design. This peptide or oligopeptide is studied for its biological activity, structure...
AlphaFold Protein Structure Database
Open database of 200+ million predicted protein structures covering nearly all known proteins. Joint project of EMBL-EBI and DeepMind.
AlphaFold: Oligopeptide Research Reference
DeepMind protein structure prediction. CASP14 winner (GDT 92.4). Nobel Prize 2024. 200M+ predicted structures. This peptide or oligopeptide is studied for it...
AlphaLISA Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using AlphaLISA. This analytical technique provides valuable insights into peptide structure, purity, and...
AlphaScreen Analysis: Analytical Technique in Peptide Res...
An analytical technique for characterizing peptides using AlphaScreen. This analytical technique provides valuable insights into peptide structure, purity, a...
ALRN-5281: Oligopeptide Research Reference
ALRN-5281, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ALRN-6924 - First-in-Human (NCT02264613)
First-in-human trial of ALRN-6924, a dual MDM2/MDMX inhibitor peptide. This peptide or oligopeptide is studied for its biological activity, structure-activit...
ALRN-6924 - MDM2/MDMX (NCT04022876)
Phase II trial of ALRN-6924 for MDM2/MDMX-driven cancers. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...
ALRN-6924: Oligopeptide Research Reference
ALRN-6924, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Als Peptides: Oligopeptide Research Reference
Peptides associated with Als including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...
ALS: Oligopeptide Research Reference
Progressive motor neuron disease affecting both upper (cortical) and lower (spinal) motor neurons. Sporadic (90%) or familial (10%, SOD1, C9orf72, TARDBP, FU...
Alyteserin-1: Antimicrobial Peptide Reference
Alyteserin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alyteserin-2: Antimicrobial Peptide Reference
Alyteserin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alytesin: Antimicrobial Peptide Reference
Alytesin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alzheimer's and Peptides: Oligopeptide Research Reference
Explore peptide approaches to Alzheimer's disease including amyloid-targeting therapies and neuroprotective peptides. Covers molecular mechanisms, biological...
Alzheimer's Disease: Oligopeptide Research Reference
Alzheimer's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Alzheimers Peptides: Oligopeptide Research Reference
Peptides associated with Alzheimers including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Amanitin: Oligopeptide Research Reference
Amanitin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Amaranth Peptide: Oligopeptide Research Reference
A bioactive peptide derived from amaranth with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Amb a 1 Immunostimulatory: Comprehensive Peptide Reference
Comprehensive reference for Amb a 1 Immunostimulatory, a peptide compound with applications in research and therapeutics.
American Peptide Symposium: Comprehensive Peptide Reference
Annual conference for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...
Amide Bonds in Peptides: Post-Translational Modification ...
Guide to amide bond chemistry, the fundamental linkage in peptide and protein structures. This modification affects peptide stability, receptor binding, and ...
Amino Acid Analysis: Analytical Technique in Peptide Rese...
Guide to amino acid analysis methods for determining peptide composition and quantifying individual residues. This peptide or oligopeptide is studied for its...
Amorphous Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Amorphous for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
AMP Activity Database: Antimicrobial Peptide Reference
Curated MIC values, hemolytic activity, and cytotoxicity data. This antimicrobial peptide demonstrates activity against pathogens and is studied for its mech...
AMP Database APD: Antimicrobial Peptide Reference
Comprehensive public database with sequences, structures, and activity data. This antimicrobial peptide demonstrates activity against pathogens and is studie...
AMP Drug Delivery: Antimicrobial Peptide Reference
Formulation strategies including nanoparticle encapsulation and hydrogel systems. This antimicrobial peptide demonstrates activity against pathogens and is s...
AMP Immunomodulation: Antimicrobial Peptide Reference
Immunomodulatory functions including chemokine activity and cytokine induction. This antimicrobial peptide demonstrates activity against pathogens and is stu...
AMP Resistance Mechanisms: Comprehensive Peptide Reference
Bacterial resistance strategies including protease secretion and membrane modification. This antimicrobial peptide demonstrates activity against pathogens an...
AMP Structural Classification: Comprehensive Peptide Refe...
Classification into alpha-helical, beta-sheet, extended, and loop conformations. This antimicrobial peptide demonstrates activity against pathogens and is st...
AMP Therapeutics Development: Comprehensive Peptide Refer...
Clinical development of defensin-based therapeutics including topical formulations. This antimicrobial peptide demonstrates activity against pathogens and is...
Amphibian AMP Database: Antimicrobial Peptide Reference
Comprehensive database of over 1000 antimicrobial peptides from amphibian skin. This antimicrobial peptide demonstrates activity against pathogens and is stu...
Amphibian Antimicrobial: Antimicrobial Peptide Reference
Amphibian Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...
Amphibian Antiviral: Antimicrobial Peptide Reference
Amphibian Antiviral is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
Amphibian Bradykinin: Antimicrobial Peptide Reference
Amphibian Bradykinin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Amphibian Caerulein: Antimicrobial Peptide Reference
Amphibian Caerulein is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
Amphibian Neuropeptide: Antimicrobial Peptide Reference
Amphibian Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Amphibian Opioid: Antimicrobial Peptide Reference
Amphibian Opioid is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological a...
Amphipathic Helix Design: Antimicrobial Peptide Reference
Rational design based on hydrophobic moment and charge distribution. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...
amphipathicity Resource: Oligopeptide Research Reference
The amphipathicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Amphotericin B: Oligopeptide Research Reference
Amphotericin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
AMPK Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
AMPK Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
AMPK Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
AMPK Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
AMPK Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the AMPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Amylin 1-13: Peptide Fragment Reference
Comprehensive reference for amylin 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 1-17: Peptide Fragment Reference
Comprehensive reference for amylin 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 1-21: Peptide Fragment Reference
Comprehensive reference for amylin 1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 1-37: Peptide Fragment Reference
Comprehensive reference for amylin 1-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 1-8: Peptide Fragment Reference
Comprehensive reference for amylin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 17-21: Peptide Fragment Reference
Comprehensive reference for amylin 17-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 17-37: Peptide Fragment Reference
Comprehensive reference for amylin 17-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 21-37: Peptide Fragment Reference
Comprehensive reference for amylin 21-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 25-37: Peptide Fragment Reference
Comprehensive reference for amylin 25-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin 8 37: Neuropeptide in Neuroscience Reference
amylin-8-37 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...
Amylin 8-21: Peptide Fragment Reference
Comprehensive reference for amylin 8-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Amylin Hormone: Endogenous Peptide Hormone Reference
Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Amylin Peptide Hormone: Endogenous Peptide Hormone Reference
Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Amylin Protein Hormone: Endogenous Peptide Hormone Reference
Amylin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Amylin: Endogenous Peptide Hormone Reference
37-amino acid peptide hormone co-secreted with insulin from pancreatic beta cells, regulating gastric emptying and glucagon.
Amyloid Beta 42: Oligopeptide Research Reference
amyloid beta 42 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Amyloid-beta → Neprilysin (Substrate)
Comprehensive reference for Amyloid-beta → Neprilysin (Substrate), a peptide compound with applications in research and therapeutics.
Amyloid-beta 40: Oligopeptide Research Reference
40-aa peptide from APP. Less aggregation-prone than Aβ42. Aβ42/40 ratio is better. This peptide or oligopeptide is studied for its biological activity, struc...
Amyloid-beta 42 (Aβ42): Oligopeptide Research Reference
Amyloid-beta 42 (Aβ42), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Amyloid-beta 42: Oligopeptide Research Reference
42-aa peptide from APP. Forms toxic plaques in Alzheimer's disease. AD biomarker. This peptide or oligopeptide is studied for its biological activity, struct...
Amyloid-beta 42/40 Ratio: Oligopeptide Research Reference
Ratio of Aβ42 to Aβ40. Decreased in amyloid pathology. Better than Aβ42 alone. This peptide or oligopeptide is studied for its biological activity, structure...
Amyloid-beta Aggregation (Self-association)
Comprehensive reference for Amyloid-beta Aggregation (Self-association), a peptide compound with applications in research and therapeutics.
Amyloid-beta oligomer: Oligopeptide Research Reference
Comprehensive reference for amyloid-beta oligomer, covering molecular structure, pharmacological properties, receptor interactions,
Amyotrophic Lateral Sclerosis (ALS)
Comprehensive reference for Amyotrophic Lateral Sclerosis (ALS), a peptide compound with applications in research and therapeutics.
Anabaena flos-aquae: Oligopeptide Research Reference
Irreversible acetylcholinesterase inhibitor. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Anakinra: Oligopeptide Research Reference
anakinra in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Analgesic / Opioid Agonist: Comprehensive Peptide Reference
Analgesic / Opioid Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...
Analysis Technologies: Oligopeptide Research Reference
Techniques for peptide characterization. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Analysis Technology Comparison
Comparison of different analytical technologies for peptide characterization. This peptide or oligopeptide is studied for its biological activity, structure-...
Analytical Ultracentrifugation for Peptides
Understand analytical ultracentrifugation for determining peptide molecular weight and oligomeric state in solution. Covers molecular mechanisms, biological ...
analytical-ultracentrifugation for Peptides
Application of analytical-ultracentrifugation technique for peptide characterization, structure determination, or formulation.
Anaphylaxis: Oligopeptide Research Reference
Severe allergic reaction to peptide drugs. Can be life-threatening. Requires immediate treatment with epinephrine. Covers molecular mechanisms, biological ac...
Androctonin: Antimicrobial Peptide Reference
Scorpion venom defensin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its...
Androstenedione Hormone: Endogenous Peptide Hormone Refer...
Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...
Androstenedione Peptide Hormone
Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...
Androstenedione Protein Hormone
Androstenedione, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and cli...
Angiotensin 1 7: Oligopeptide Research Reference
angiotensin 1 7 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Angiotensin 1-7: Peptide Fragment Reference
Heptapeptide counter-regulatory hormone of the RAAS that opposes angiotensin II effects through Mas receptor activation.
Angiotensin Family Peptides: Comprehensive Peptide Reference
Learn about angiotensin I-IV peptides in the renin-angiotensin system and blood pressure regulation. This peptide or oligopeptide is studied for its biologic...
Angiotensin I → ACE (Substrate)
Comprehensive reference for Angiotensin I → ACE (Substrate), a peptide compound with applications in research and therapeutics.
Angiotensin I Hormone: Endogenous Peptide Hormone Reference
Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...
Angiotensin I Peptide Hormone: Comprehensive Peptide Refe...
Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...
Angiotensin I Protein Hormone: Comprehensive Peptide Refe...
Angiotensin I, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clini...
Angiotensin I: Oligopeptide Research Reference
Angiotensin I is a decapeptide generated from angiotensinogen by renin, serving as the obligate substrate for angiotensin-converting enzyme in the renin-angi...
Angiotensin I: Oligopeptide Research Reference
angiotensin I in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Angiotensin II Hormone: Endogenous Peptide Hormone Reference
Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Angiotensin II Peptide Hormone
Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Angiotensin II Protein Hormone
Angiotensin II, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Angiotensin II: Endogenous Peptide Hormone Reference
Octapeptide vasoconstrictor hormone of the renin-angiotensin system that regulates blood pressure and fluid balance. Covers molecular mechanisms, biological ...
Angiotensin II: Oligopeptide Research Reference
angiotensin II in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Angiotensin III: Oligopeptide Research Reference
angiotensin III in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Angiotensin IV: Oligopeptide Research Reference
angiotensin IV in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Anidulafungin: Oligopeptide Research Reference
Echinocandin with long half-life for candidiasis without hepatic or renal dose adjustment. This peptide or oligopeptide is studied for its biological activit...
Anidulafungin: Oligopeptide Research Reference
anidulafungin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Animal Nutrition: Oligopeptide Research Reference
Use of bioactive peptides in animal feed. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Annexin A1: Oligopeptide Research Reference
annexin A1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
ANP 11-28: Peptide Fragment Reference
Comprehensive reference for ANP 11-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 13-28: Peptide Fragment Reference
Comprehensive reference for ANP 13-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 15-28: Peptide Fragment Reference
Comprehensive reference for ANP 15-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 17-28: Peptide Fragment Reference
Comprehensive reference for ANP 17-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 19-28: Peptide Fragment Reference
Comprehensive reference for ANP 19-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 21-28: Peptide Fragment Reference
Comprehensive reference for ANP 21-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 23-28: Peptide Fragment Reference
Comprehensive reference for ANP 23-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 25-28: Peptide Fragment Reference
Comprehensive reference for ANP 25-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 27-28: Peptide Fragment Reference
Comprehensive reference for ANP 27-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 3-28: Peptide Fragment Reference
Comprehensive reference for ANP 3-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 5-28: Peptide Fragment Reference
Comprehensive reference for ANP 5-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 7-28: Peptide Fragment Reference
Comprehensive reference for ANP 7-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP 9-28: Peptide Fragment Reference
Comprehensive reference for ANP 9-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
ANP Fragment: Oligopeptide Research Reference
ANP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
ANP Hormone: Endogenous Peptide Hormone Reference
ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
ANP Peptide Hormone: Endogenous Peptide Hormone Reference
ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
ANP Protein Hormone: Endogenous Peptide Hormone Reference
ANP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
ANP(1 28): Endogenous Peptide Hormone Reference
ANP(1-28) is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.
ANP(99 126): Endogenous Peptide Hormone Reference
ANP(99-126) is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.
Anserine: Oligopeptide Research Reference
β-alanyl-Nτ-methyl-L-histidine. Dipeptide in muscle tissue. pH buffer, antioxidant. Found in poultry, marine fish. Covers molecular mechanisms, biological ac...
Antamanide: Oligopeptide Research Reference
Antamanide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Anti-Aging: Oligopeptide Research Reference
Peptide-based approaches to skin aging. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Anti-Drug Antibodies (ADA): Comprehensive Peptide Reference
Antibodies generated against therapeutic peptides. Can reduce efficacy and cause allergic reactions. This peptide or oligopeptide is studied for its biologic...
Anti-Infective / Cyclic Peptide Antibiotic
Anti-Infective / Cyclic Peptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics.
Anti-Infective / Lipoglycopeptide Antibiotic
Anti-Infective / Lipoglycopeptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics.
Anti-Infective / Lipopeptide Antibiotic
Anti-Infective / Lipopeptide Antibiotic is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...
Anti-infective: Oligopeptide Research Reference
Clinical trials for infectious diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Antibiotic Interactions: Oligopeptide Research Reference
Drug interactions between peptide antibiotics and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Antibody Conjugation Synthesis
A peptide synthesis method using Antibody Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Antibody-drug conjugate: Oligopeptide Research Reference
Comprehensive reference for antibody-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Anticoagulant Interactions: Comprehensive Peptide Reference
Drug interactions between anticoagulant peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Antidiabetic Interactions: Comprehensive Peptide Reference
Drug interactions between peptide diabetes drugs and other medications. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Antifungal Peptide Drugs: Oligopeptide Research Reference
Peptide-based antifungal agents including lipopeptides and cyclic peptides for invasive fungal infections. This peptide or oligopeptide is studied for its bi...
Antimicrobial Peptide Drugs: Comprehensive Peptide Reference
Therapeutic antimicrobial peptides for drug-resistant infections including cationic and lipopeptide classes. This peptide or oligopeptide is studied for its ...
Antimicrobial Peptide Library AMP-library-1
Comprehensive reference for antimicrobial peptide library AMP-library-1, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-10
Comprehensive reference for antimicrobial peptide library AMP-library-10, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-11
Comprehensive reference for antimicrobial peptide library AMP-library-11, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-12
Comprehensive reference for antimicrobial peptide library AMP-library-12, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-13
Comprehensive reference for antimicrobial peptide library AMP-library-13, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-14
Comprehensive reference for antimicrobial peptide library AMP-library-14, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-15
Comprehensive reference for antimicrobial peptide library AMP-library-15, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-16
Comprehensive reference for antimicrobial peptide library AMP-library-16, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-17
Comprehensive reference for antimicrobial peptide library AMP-library-17, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-18
Comprehensive reference for antimicrobial peptide library AMP-library-18, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-19
Comprehensive reference for antimicrobial peptide library AMP-library-19, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-2
Comprehensive reference for antimicrobial peptide library AMP-library-2, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-20
Comprehensive reference for antimicrobial peptide library AMP-library-20, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-21
Comprehensive reference for antimicrobial peptide library AMP-library-21, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-22
Comprehensive reference for antimicrobial peptide library AMP-library-22, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-23
Comprehensive reference for antimicrobial peptide library AMP-library-23, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-24
Comprehensive reference for antimicrobial peptide library AMP-library-24, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-25
Comprehensive reference for antimicrobial peptide library AMP-library-25, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-26
Comprehensive reference for antimicrobial peptide library AMP-library-26, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-27
Comprehensive reference for antimicrobial peptide library AMP-library-27, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-28
Comprehensive reference for antimicrobial peptide library AMP-library-28, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-29
Comprehensive reference for antimicrobial peptide library AMP-library-29, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-3
Comprehensive reference for antimicrobial peptide library AMP-library-3, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-30
Comprehensive reference for antimicrobial peptide library AMP-library-30, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-31
Comprehensive reference for antimicrobial peptide library AMP-library-31, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-32
Comprehensive reference for antimicrobial peptide library AMP-library-32, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-33
Comprehensive reference for antimicrobial peptide library AMP-library-33, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-34
Comprehensive reference for antimicrobial peptide library AMP-library-34, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-35
Comprehensive reference for antimicrobial peptide library AMP-library-35, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-36
Comprehensive reference for antimicrobial peptide library AMP-library-36, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-37
Comprehensive reference for antimicrobial peptide library AMP-library-37, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-38
Comprehensive reference for antimicrobial peptide library AMP-library-38, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-39
Comprehensive reference for antimicrobial peptide library AMP-library-39, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-4
Comprehensive reference for antimicrobial peptide library AMP-library-4, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-40
Comprehensive reference for antimicrobial peptide library AMP-library-40, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-41
Comprehensive reference for antimicrobial peptide library AMP-library-41, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-42
Comprehensive reference for antimicrobial peptide library AMP-library-42, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-43
Comprehensive reference for antimicrobial peptide library AMP-library-43, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-44
Comprehensive reference for antimicrobial peptide library AMP-library-44, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-45
Comprehensive reference for antimicrobial peptide library AMP-library-45, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-46
Comprehensive reference for antimicrobial peptide library AMP-library-46, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-47
Comprehensive reference for antimicrobial peptide library AMP-library-47, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-48
Comprehensive reference for antimicrobial peptide library AMP-library-48, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-49
Comprehensive reference for antimicrobial peptide library AMP-library-49, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-5
Comprehensive reference for antimicrobial peptide library AMP-library-5, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-50
Comprehensive reference for antimicrobial peptide library AMP-library-50, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-51
Comprehensive reference for antimicrobial peptide library AMP-library-51, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-52
Comprehensive reference for antimicrobial peptide library AMP-library-52, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-53
Comprehensive reference for antimicrobial peptide library AMP-library-53, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-54
Comprehensive reference for antimicrobial peptide library AMP-library-54, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-55
Comprehensive reference for antimicrobial peptide library AMP-library-55, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-56
Comprehensive reference for antimicrobial peptide library AMP-library-56, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-57
Comprehensive reference for antimicrobial peptide library AMP-library-57, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-58
Comprehensive reference for antimicrobial peptide library AMP-library-58, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-59
Comprehensive reference for antimicrobial peptide library AMP-library-59, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-6
Comprehensive reference for antimicrobial peptide library AMP-library-6, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-60
Comprehensive reference for antimicrobial peptide library AMP-library-60, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-7
Comprehensive reference for antimicrobial peptide library AMP-library-7, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-8
Comprehensive reference for antimicrobial peptide library AMP-library-8, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Library AMP-library-9
Comprehensive reference for antimicrobial peptide library AMP-library-9, covering molecular structure, pharmacological properties, receptor interactions,
Antimicrobial Peptide Market: Comprehensive Peptide Refer...
Market analysis for antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Antimicrobial Peptide Overdose
Excessive dosing of antimicrobial peptides. Can cause toxicity and resistance. This peptide or oligopeptide is studied for its biological activity, structure...
Antimicrobial Peptides: Oligopeptide Research Reference
Antimicrobial (Gram-negative focus). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Antimicrobial Synthetic: Oligopeptide Research Reference
Engineered antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Antioxidant Peptides (General)
Comprehensive reference for Antioxidant Peptides (General), a peptide compound with applications in research and therapeutics.
Antisense oligonucleotide: Comprehensive Peptide Reference
Comprehensive reference for antisense oligonucleotide, covering molecular structure, pharmacological properties, receptor interactions,
Antithymocyte Globulin: Oligopeptide Research Reference
Polyclonal antibody preparation against human T cells used for transplant induction and acute rejection treatment. Covers molecular mechanisms, biological ac...
Antiviral Peptides: Therapeutics Against Emerging Viruses
Comprehensive overview of peptide-based antivirals targeting viral entry, replication, and assembly. This peptide or oligopeptide is studied for its biologic...
Anxiety and Peptides: Oligopeptide Research Reference
Learn about anxiolytic peptide therapeutics targeting neuropeptide Y, CRF, and GABAergic peptide systems. This peptide or oligopeptide is studied for its bio...
Anxiety Disorders: Oligopeptide Research Reference
Group of disorders characterized by excessive fear and anxiety. Includes GAD, social anxiety, panic disorder, specific phobias. Treatments: SSRIs, SNRIs, ben...
Anxiety Peptides: Oligopeptide Research Reference
Peptides associated with Anxiety including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Aortic Aneurysm: Oligopeptide Research Reference
Aortic Aneurysm, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Apamin (Apis): Oligopeptide Research Reference
Apamin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Apamin: Oligopeptide Research Reference
Bee venom neurotoxic peptide that selectively blocks small-conductance calcium-activated potassium channels. This peptide or oligopeptide is studied for its ...
Apamin: Peptide Toxin in Pharmacology Reference
Apamin is an 18-amino acid bee venom neurotoxin that selectively blocks small-conductance calcium-activated potassium channels (SK channels), used as a neuro...
APC Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting APC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
APD3 (Antimicrobial Peptide Database)
Comprehensive database of antimicrobial peptides with sequences and activities. This peptide or oligopeptide is studied for its biological activity, structur...
APD3: Oligopeptide Research Reference
Antimicrobial Peptide Database. Comprehensive database of antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, struct...
Apelin Hormone: Endogenous Peptide Hormone Reference
Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Apelin Peptide Hormone: Endogenous Peptide Hormone Reference
Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Apelin Protein Hormone: Endogenous Peptide Hormone Reference
Apelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Apelin: Oligopeptide Research Reference
Apelin is an adipokine peptide that activates the APJ receptor to regulate cardiovascular function, fluid homeostasis, and energy metabolism.
Apidaecin: Antimicrobial Peptide Reference
Proline-rich AMP from honeybee hemolymph inhibiting bacterial protein synthesis. This antimicrobial peptide demonstrates activity against pathogens and is st...
Appetite-Regulating Peptides: Comprehensive Peptide Refer...
Network of neuropeptides controlling hunger, satiety, and energy balance. This neuropeptide is involved in neurological signaling and is studied for its role...
Apple Peptide: Oligopeptide Research Reference
A bioactive peptide derived from apple with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Applied Photophysics Chirascan
Circular dichroism spectrometer for protein secondary structure analysis. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Approved Therapeutics: Oligopeptide Research Reference
Approved Therapeutics, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Aprotinin: Oligopeptide Research Reference
aprotinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Aptamer Conjugation Synthesis: Comprehensive Peptide Refe...
A peptide synthesis method using Aptamer Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...
Aptamer Drug System 1: Oligopeptide Research Reference
A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Aptamer Drug System 2: Oligopeptide Research Reference
A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Aptamer Drug System 3: Oligopeptide Research Reference
A aptamer-drug-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Aptamer System 1: Oligopeptide Research Reference
A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Aptamer System 2: Oligopeptide Research Reference
A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Aptamer System 3: Oligopeptide Research Reference
A aptamer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Aptamer-drug conjugate: Oligopeptide Research Reference
Comprehensive reference for aptamer-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Aptamer: Oligopeptide Research Reference
Comprehensive reference for aptamer, covering molecular structure, pharmacological properties, receptor interactions,
Aquaculture: Oligopeptide Research Reference
Use of antimicrobial peptides in aquaculture. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
Argatroban: Oligopeptide Research Reference
Synthetic direct thrombin inhibitor for heparin-induced thrombocytopenia with active site binding. This peptide or oligopeptide is studied for its biological...
Arginine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Arginine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...
Arginine Modification: Post-Translational Modification Re...
Post-translational modifications of Arginine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...
Arginine Peptide: Oligopeptide Research Reference
Arginine (R) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...
Argipressin: Oligopeptide Research Reference
Argipressin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Argireline: Oligopeptide Research Reference
Acetyl hexapeptide-3. Inhibits SNARE complex. Topical anti-wrinkle peptide (mild Botox-like effect). This peptide or oligopeptide is studied for its biologic...
Arrhythmia Peptides: Oligopeptide Research Reference
Peptides associated with Arrhythmia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Arrhythmia: Oligopeptide Research Reference
Arrhythmia, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Artemin Hormone: Endogenous Peptide Hormone Reference
Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Artemin Peptide Hormone: Endogenous Peptide Hormone Refer...
Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Artemin Protein Hormone: Endogenous Peptide Hormone Refer...
Artemin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Arthritis and Peptides: Oligopeptide Research Reference
Discover peptide-based therapies for rheumatoid and osteoarthritis including anti-inflammatory and joint-protective peptides.
ASO System 1: Oligopeptide Research Reference
A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
ASO System 2: Oligopeptide Research Reference
A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
ASO System 3: Oligopeptide Research Reference
A ASO-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
Asp49 PLA2: Peptide Toxin in Pharmacology Reference
Asp49-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...
Asparagine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Asparagine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...
Asparagine Modification: Post-Translational Modification ...
Post-translational modifications of Asparagine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...
Asparagine Peptide: Oligopeptide Research Reference
Asparagine (N) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...
Asparagus Peptide: Oligopeptide Research Reference
A bioactive peptide derived from asparagus with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
Aspart Pump Cartridge: Oligopeptide Research Reference
Preservative-free insulin aspart for pump cartridges with 48-hour reservoir dwell time stability. This peptide or oligopeptide is studied for its biological ...
Aspartate Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Aspartate including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...
Aspartate Modification: Post-Translational Modification R...
Post-translational modifications of Aspartate including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...
Aspartate Peptide: Oligopeptide Research Reference
Aspartate (D) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...
Assignee: Oligopeptide Research Reference
Key Products. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
association-constant Resource: Comprehensive Peptide Refe...
The association-constant database or resource for peptide research, providing data on structure, function, and interactions.
Astaxanthin Peptide: Oligopeptide Research Reference
astaxanthin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Astaxanthin-Peptide Conjugates
Comprehensive reference for Astaxanthin-Peptide Conjugates, a peptide compound with applications in research and therapeutics.
Asthma Peptides: Oligopeptide Research Reference
Peptides associated with Asthma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
AstraZeneca: Oligopeptide Research Reference
Goserelin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...
Atezolizumab: Oligopeptide Research Reference
atezolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Atherosclerosis Peptides: Oligopeptide Research Reference
Peptides associated with Atherosclerosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...
Atherosclerosis: Oligopeptide Research Reference
Arterial wall inflammation, lipid accumulation, plaque formation. Treatments: statins, antiplatelets, PCSK9 inhibitors. Covers molecular mechanisms, biologic...
Atogepant: Oligopeptide Research Reference
Oral CGRP receptor antagonist for episodic migraine prevention with daily dosing. This peptide or oligopeptide is studied for its biological activity, struct...
Atomic Force Microscopy: Oligopeptide Research Reference
AFM for imaging peptide and protein structures at nanometer resolution. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Atosiban: Oligopeptide Research Reference
Oxytocin receptor antagonist for preterm labor with D-Tyr providing competitive myometrial relaxation. This peptide or oligopeptide is studied for its biolog...
Atrial Natriuretic Peptide: Comprehensive Peptide Reference
A 28-amino acid cardiac peptide that promotes natriuresis, diuresis, and vasodilation to regulate blood volume and pressure.
ATSP-7041 - First-in-Human (NCT02264614)
First-in-human trial of ATSP-7041, a stapled peptide MDM2 antagonist. This peptide or oligopeptide is studied for its biological activity, structure-activity...
ATSP-7041 - MDM2/MDMX (NCT04022877)
Phase II trial of ATSP-7041 for MDM2/MDMX-driven cancers. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...
ATSP-7041: Oligopeptide Research Reference
ATSP-7041, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Attacin (Hyalophora): Oligopeptide Research Reference
Attacin (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Attacin E: Antimicrobial Peptide Reference
AMP from Hyalophora cecropia with antibacterial activity targeting outer membrane. This antimicrobial peptide demonstrates activity against pathogens and is ...
Attention for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using Attention. This analytical technique provides valuable insights into peptide structure, purity, and charac...
ATX-II: Peptide Toxin in Pharmacology Reference
ATX-II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ATX-MS-1467: Oligopeptide Research Reference
ATX-MS-1467, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
AUC Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using AUC. This analytical technique provides valuable insights into peptide structure, purity, and chara...
AUC-PR Resource: Oligopeptide Research Reference
The AUC-PR database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...
AUC-ROC Resource: Oligopeptide Research Reference
The AUC-ROC database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...
Augmentin: Antimicrobial Peptide Reference
augmentin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biologi...
Autism Peptides: Oligopeptide Research Reference
Peptides associated with Autism including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Autoencoder for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using Autoencoder. This analytical technique provides valuable insights into peptide structure, purity, and char...
Autoimmune / Multiple Sclerosis
Autoimmune / Multiple Sclerosis is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Autoimmune Diseases and Peptides
Understand peptide immunotherapies for autoimmune conditions including tolerance induction and cytokine modulation. Covers molecular mechanisms, biological a...
Autoimmune Diseases: Oligopeptide Research Reference
Immune system attacks self-tissues. >80 known autoimmune diseases. Examples: RA, lupus, MS, type 1 diabetes, IBD, psoriasis. Treatments: immunosuppressants, ...
Autoimmune Peptides: Oligopeptide Research Reference
Peptides associated with Autoimmune including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Automated SPPS: Oligopeptide Research Reference
mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Avalglucosidase Alfa: Oligopeptide Research Reference
Avalglucosidase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Avelumab: Oligopeptide Research Reference
avelumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Avian Beta-Defensin 1 (AvBD1): Comprehensive Peptide Refe...
Comprehensive reference for Avian Beta-Defensin 1 (AvBD1), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 1 (Chicken)
Comprehensive reference for Avian Beta-Defensin 1 (Chicken), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 2 (Chicken)
Comprehensive reference for Avian Beta-Defensin 2 (Chicken), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 3 (AvBD3): Comprehensive Peptide Refe...
Comprehensive reference for Avian Beta-Defensin 3 (AvBD3), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 3 (Chicken)
Comprehensive reference for Avian Beta-Defensin 3 (Chicken), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 4 (Chicken)
Comprehensive reference for Avian Beta-Defensin 4 (Chicken), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 5 (AvBD5): Comprehensive Peptide Refe...
Comprehensive reference for Avian Beta-Defensin 5 (AvBD5), a peptide compound with applications in research and therapeutics.
Avian Beta-Defensin 5 (Chicken)
Comprehensive reference for Avian Beta-Defensin 5 (Chicken), a peptide compound with applications in research and therapeutics.
Avian Serum Peptides: Oligopeptide Research Reference
Avian Serum Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Avibactam: Oligopeptide Research Reference
Diazabicyclooctane beta-lactamase inhibitor that restores activity of cephalosporins against resistant gram-negative bacteria.
Avidin Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using Avidin. This analytical technique provides valuable insights into peptide structure, pur...
Avocado Peptide: Oligopeptide Research Reference
A bioactive peptide derived from avocado with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Azaspiracid: Oligopeptide Research Reference
Azaspiracid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Azide Alkyne Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Azide Alkyne for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
Azido Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using Azido. This analytical technique provides valuable insights into peptide structure, puri...
B Anthracis Peptide: Oligopeptide Research Reference
A peptide associated with B Anthracis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
B Burgdorferi Peptide: Oligopeptide Research Reference
A peptide associated with B Burgdorferi for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
B Cereus Peptide: Oligopeptide Research Reference
A peptide associated with B Cereus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
B Henselae Peptide: Oligopeptide Research Reference
A peptide associated with B Henselae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...
B Pertussis Peptide: Oligopeptide Research Reference
A peptide associated with B Pertussis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
B-cerulein: Antimicrobial Peptide Reference
B-cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bac5: Oligopeptide Research Reference
Bac5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bac7: Oligopeptide Research Reference
Bac7, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bacitracin: Antimicrobial Peptide Reference
bacitracin is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Backbone Mod System 1: Oligopeptide Research Reference
A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Backbone Mod System 2: Oligopeptide Research Reference
A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Backbone Mod System 3: Oligopeptide Research Reference
A backbone-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Backbone: Post-Translational Modification Reference
Hours–days. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...
Bactenecin: Oligopeptide Research Reference
Bactenecin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bacterial Toxins: Oligopeptide Research Reference
Neuromuscular / cytotoxic. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
Bacteriocins: Oligopeptide Research Reference
Antimicrobial (Gram-positive). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Bacterium: Peptide Toxin in Pharmacology Reference
0.000001 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in res...
Balenine: Oligopeptide Research Reference
balenine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Bam 22: Neuropeptide in Neuroscience Reference
bam-22 is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation. Covers molecular mechanisms, biologica...
Banana Peptide: Oligopeptide Research Reference
A bioactive peptide derived from banana with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Barley Peptide: Oligopeptide Research Reference
A bioactive peptide derived from barley with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Basal Insulin Analogue Design Principles
Rational design principles for engineering ultra-long-acting basal insulin analogues with flat pharmacokinetic profiles.
Basal-Bolus Insulin Regimens: Comprehensive Peptide Refer...
Intensive insulin therapy combining basal insulin analogue with rapid-acting prandial insulin doses. This peptide or oligopeptide is studied for its biologic...
Base Labile Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Base Labile. This analytical technique provides valuable insights into peptide structure...
Basic PLA2: Peptide Toxin in Pharmacology Reference
basic-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...
Basiliximab: Oligopeptide Research Reference
Chimeric anti-CD25 monoclonal antibody that prevents acute rejection in kidney transplant by blocking IL-2 receptor activation.
Batch Release Testing: Oligopeptide Research Reference
Understand batch release testing requirements for peptide drugs including identity, purity, potency, and sterility assays.
Batrachotoxin: Peptide Toxin in Pharmacology Reference
Batrachotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BCL 2 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting BCL 2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
BCL XL Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting BCL XL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...
Bdellin: Oligopeptide Research Reference
Bdellin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BDNF Hormone: Endogenous Peptide Hormone Reference
BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
BDNF Mimetic: Oligopeptide Research Reference
BDNF mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
BDNF Peptide Hormone: Endogenous Peptide Hormone Reference
BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
BDNF Protein Hormone: Endogenous Peptide Hormone Reference
BDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
BDS-I (Blood Depressor Substance I)
Comprehensive reference for BDS-I (Blood Depressor Substance I), a peptide compound with applications in research and therapeutics.
BDS-I: Peptide Toxin in Pharmacology Reference
BDS-I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bean Peptide: Oligopeptide Research Reference
A bioactive peptide derived from bean with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Beauvericin: Oligopeptide Research Reference
Beauvericin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bee Venom Adolapin: Peptide Toxin in Pharmacology Reference
Anti-inflammatory peptide from bee venom inhibiting cyclooxygenase activity. This peptide toxin is derived from venom and studied for its pharmacological act...
Bee Venom Anti-Inflammatory: Comprehensive Peptide Reference
Therapeutic anti-inflammatory applications of bee venom components. This peptide toxin is derived from venom and studied for its pharmacological activity, me...
Bee Venom Apamin: Peptide Toxin in Pharmacology Reference
Selective SK potassium channel blocker from honeybee venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism ...
Bee Venom Apitherapy: Peptide Toxin in Pharmacology Refer...
Clinical applications of bee venom in traditional and integrative medicine. This peptide toxin is derived from venom and studied for its pharmacological acti...
Bee Venom Mastoparan: Peptide Toxin in Pharmacology Refer...
Mast cell degranulating peptide from bee venom causing histamine release. This peptide toxin is derived from venom and studied for its pharmacological activi...
Bee Venom Melittin: Peptide Toxin in Pharmacology Reference
Pharmacological applications of melittin beyond bee sting toxicity. This peptide toxin is derived from venom and studied for its pharmacological activity, me...
Bee Venom Neuroprotective: Comprehensive Peptide Reference
Neuroprotective properties of bee venom components in neurodegenerative disease. This peptide toxin is derived from venom and studied for its pharmacological...
Bee Venom Phospholipase A2: Comprehensive Peptide Reference
Major allergenic enzyme component of honeybee venom with inflammatory effects. This peptide toxin is derived from venom and studied for its pharmacological a...
Bee: Peptide Toxin in Pharmacology Reference
4.0 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in research...
Bee/Wasp Venoms: Peptide Toxin in Pharmacology Reference
Membranes, K+, G-proteins, nAChR. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential a...
Bepranemab: Oligopeptide Research Reference
Bepranemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BERT for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using BERT. This analytical technique provides valuable insights into peptide structure, purity, and characteriz...
Beta Bungarotoxin: Peptide Toxin in Pharmacology Reference
beta-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmac...
Beta Defensin 1: Antimicrobial Peptide Reference
beta-defensin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Beta Defensin 2: Antimicrobial Peptide Reference
beta-defensin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Beta Defensin 3: Antimicrobial Peptide Reference
beta-defensin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Beta Defensin 4: Antimicrobial Peptide Reference
beta-defensin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Beta-Amino Acids: Oligopeptide Research Reference
Amino acids with β-amino group. Enhance proteolytic resistance in peptides. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Beta-Defensin Dimerization: Comprehensive Peptide Reference
Homodimer formation enhancing antimicrobial potency through avidity effects. This antimicrobial peptide demonstrates activity against pathogens and is studie...
Beta-Endorphin Central: Neuropeptide in Neuroscience Refe...
Central effects of beta-endorphin on pain, reward, and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Beta-Endorphin: Neuropeptide in Neuroscience Reference
A 31-amino acid endogenous opioid peptide derived from proopiomelanocortin (POMC) that produces potent analgesia and euphoria through mu-opioid receptor acti...
Beta-hCG: Oligopeptide Research Reference
Beta subunit of hCG. Trophoblast hormone. Pregnancy and GTD biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Beta-Neo-Endorphin: Neuropeptide in Neuroscience Reference
Prodynorphin-derived opioid with kappa-selectivity in hypothalamus. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Betatrophin Hormone: Endogenous Peptide Hormone Reference
Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Betatrophin Peptide Hormone: Comprehensive Peptide Reference
Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Betatrophin Protein Hormone: Comprehensive Peptide Reference
Betatrophin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Betatrophin: Structure, Function, and Significance
Betatrophin (FGF21-like) is a hormone that promotes beta-cell proliferation and may play a role in type 2 diabetes. Covers molecular mechanisms, biological a...
Big Dynorphin: Neuropeptide in Neuroscience Reference
Precursor form containing both dynorphin A and B sequences. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fun...
Big Endothelin: Oligopeptide Research Reference
big endothelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Bimatoprost: Oligopeptide Research Reference
Bimatoprost, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
binding-affinity Resource: Comprehensive Peptide Reference
The binding-affinity database or resource for peptide research, providing data on structure, function, and interactions.
Binding: Oligopeptide Research Reference
Non-covalent molecular recognition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Binds basigin (CD147) for merozoite invasion
Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
Binds cell wall mannan, disrupts membrane
Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Binds cell wall receptor, disrupts membrane
Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Binds ergosterol, forms membrane pores
Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Binds Nav1.x, shifts activation potential
Dinoflagellate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
Binds Ste2p GPCR receptor, activates MAPK cascade
Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Binds to membrane receptor, forms channels
Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Binds to PKA regulatory domain
Yeast signaling peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Bioactive Egg White Peptides: Comprehensive Peptide Refer...
Comprehensive reference for Bioactive Egg White Peptides, a peptide compound with applications in research and therapeutics.
Bioanalytical Method Validation
Understand bioanalytical method validation requirements for quantifying peptides in pharmacokinetic and toxicology studies.
BioBERT for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using BioBERT. This analytical technique provides valuable insights into peptide structure, purity, and characte...
Biocatalysis: Oligopeptide Research Reference
Enzymatic methods for peptide synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Biocatalytic Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Biocatalytic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
Bioconjugate Chemistry: Oligopeptide Research Reference
Journal focused on bioconjugation chemistry and its applications. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Bioconjugation Synthesis: Analytical Technique in Peptide...
A peptide synthesis method using Bioconjugation for producing peptides with specific properties. This analytical technique provides valuable insights into pe...
Biomanufacturing: Oligopeptide Research Reference
Large-scale production of peptides using biotechnology methods. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
biomarker-response Resource: Comprehensive Peptide Reference
The biomarker-response database or resource for peptide research, providing data on structure, function, and interactions.
Biomaterials: Oligopeptide Research Reference
Peptide-based biomaterials for tissue engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Biopeptide EL: Oligopeptide Research Reference
Acetyl tetrapeptide-3. Stimulates extracellular matrix. Anti-aging hair care. This peptide or oligopeptide is studied for its biological activity, structure-...
Biosensor Analysis for Peptides
Explore label-free biosensor platforms for real-time monitoring of peptide binding and enzymatic activity. This peptide or oligopeptide is studied for its bi...
Biosensors: Oligopeptide Research Reference
Peptide-based biosensors for detecting analytes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Biosimilar Peptides: Regulatory and Development Pathways
Navigate the complex regulatory landscape for biosimilar peptide drugs, from analytical similarity to clinical confirmation.
Biosimilar Premixed 70/30: Comprehensive Peptide Reference
Biosimilar intermediate premixed insulin combining 70% NPH and 30% regular human insulin. This peptide or oligopeptide is studied for its biological activity...
Biotage Syro: Oligopeptide Research Reference
Automated peptide synthesizer for SPPS. High-throughput parallel synthesis. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Biotin Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using Biotin. This analytical technique provides valuable insights into peptide structure, pur...
Biotin-Streptavidin: Oligopeptide Research Reference
Biotin-Streptavidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Biotinylation Synthesis: Analytical Technique in Peptide ...
A peptide synthesis method using Biotinylation for producing peptides with specific properties. This analytical technique provides valuable insights into pep...
Bipolar Peptides: Oligopeptide Research Reference
Peptides associated with Bipolar including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Bispecific antibody: Oligopeptide Research Reference
Comprehensive reference for bispecific antibody, covering molecular structure, pharmacological properties, receptor interactions,
Bispecific System 1: Oligopeptide Research Reference
A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Bispecific System 2: Oligopeptide Research Reference
A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Bispecific System 3: Oligopeptide Research Reference
A bispecific-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Bivalirudin: Oligopeptide Research Reference
Direct thrombin inhibitor bivalent hirudin analog for PCI and heparin-induced thrombocytopenia. This peptide or oligopeptide is studied for its biological ac...
Bivalirudin: Oligopeptide Research Reference
Synthetic 20-amino acid direct thrombin inhibitor derived from hirudin, used as an anticoagulant during percutaneous coronary intervention.
Bivalirudin: Oligopeptide Research Reference
bivalirudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Blackberry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from blackberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Bladder Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Bladder Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...
Bleomycin Glycopeptide Antibiotic
Glycopeptide antitumor antibiotic generating free radicals causing DNA strand breaks, used for Hodgkin lymphoma and germ cell tumors.
Bleomycin: Oligopeptide Research Reference
Glycopeptide antibiotic used as a chemotherapeutic agent that induces DNA strand breaks via metal-dependent oxidative cleavage.
BLI Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using BLI. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Blood Disorders and Peptides: Comprehensive Peptide Refer...
Learn about peptide-based treatments for hematological conditions including thrombocytopenia and anemia. This peptide or oligopeptide is studied for its biol...
Blueberry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from blueberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
BM32: Oligopeptide Research Reference
BM32, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BMAP-27: Oligopeptide Research Reference
BMAP-27, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BMAP-28: Oligopeptide Research Reference
BMAP-28, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BmK AGAP: Peptide Toxin in Pharmacology Reference
BmK AGAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BMP 2 Hormone: Endogenous Peptide Hormone Reference
BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 2 Peptide Hormone: Endogenous Peptide Hormone Reference
BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 2 Protein Hormone: Endogenous Peptide Hormone Reference
BMP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 2: Endogenous Peptide Hormone Reference
BMP-2 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...
BMP 4 Hormone: Endogenous Peptide Hormone Reference
BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 4 Peptide Hormone: Endogenous Peptide Hormone Reference
BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 4 Protein Hormone: Endogenous Peptide Hormone Reference
BMP 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 4: Endogenous Peptide Hormone Reference
BMP-4 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...
BMP 7 Hormone: Endogenous Peptide Hormone Reference
BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 7 Peptide Hormone: Endogenous Peptide Hormone Reference
BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 7 Protein Hormone: Endogenous Peptide Hormone Reference
BMP 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
BMP 7: Endogenous Peptide Hormone Reference
BMP-7 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...
BMP Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting BMP Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
BNP → Neprilysin (Substrate): Comprehensive Peptide Refer...
BNP as a substrate for neprilysin enzyme, relevant to sacubitril/valsartan heart failure therapy. This peptide or oligopeptide is studied for its biological ...
BNP 1-32: Peptide Fragment Reference
Comprehensive reference for BNP 1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 10-32: Peptide Fragment Reference
Comprehensive reference for BNP 10-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 13-32: Peptide Fragment Reference
Comprehensive reference for BNP 13-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 18-32: Peptide Fragment Reference
Comprehensive reference for BNP 18-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 22-32: Peptide Fragment Reference
Comprehensive reference for BNP 22-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 26-32: Peptide Fragment Reference
Comprehensive reference for BNP 26-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 28-32: Peptide Fragment Reference
Comprehensive reference for BNP 28-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 3-32: Peptide Fragment Reference
Comprehensive reference for BNP 3-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 32: Endogenous Peptide Hormone Reference
BNP-32 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...
BNP 32: Oligopeptide Research Reference
BNP 32 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
BNP 5-32: Peptide Fragment Reference
Comprehensive reference for BNP 5-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 7-32: Peptide Fragment Reference
Comprehensive reference for BNP 7-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP 8-32: Peptide Fragment Reference
Comprehensive reference for BNP 8-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
BNP Hormone: Endogenous Peptide Hormone Reference
BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
BNP Peptide Hormone: Endogenous Peptide Hormone Reference
BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
BNP Protein Hormone: Endogenous Peptide Hormone Reference
BNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
BNP: Oligopeptide Research Reference
32-amino acid natriuretic peptide cleaved from 108-aa proBNP precursor by furin-like proteases. Released by cardiac ventricles in response to volume overload...
Boc Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Boc for producing peptides with specific properties. This analytical technique provides valuable insights into peptide struc...
Bombesin: Neuropeptide in Neuroscience Reference
A tetradecapeptide originally isolated from frog skin that binds bombesin/GRP receptors and regulates growth, feeding, and cancer biology.
bond-angle Resource: Oligopeptide Research Reference
The bond-angle database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ac...
bond-length Resource: Oligopeptide Research Reference
The bond-length database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Bone / Calcitonin Analog: Oligopeptide Research Reference
Bone / Calcitonin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Bone / Calcitonin: Oligopeptide Research Reference
Bone / Calcitonin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ...
Bone Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Bone Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Bone Disorders: Oligopeptide Research Reference
Peptide therapeutics for osteoporosis and bone healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Bone Morphogenetic Protein BMP-10
Comprehensive reference for bone morphogenetic protein BMP-10, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-12
Comprehensive reference for bone morphogenetic protein BMP-12, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-13
Comprehensive reference for bone morphogenetic protein BMP-13, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-14
Comprehensive reference for bone morphogenetic protein BMP-14, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-15
Comprehensive reference for bone morphogenetic protein BMP-15, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-16
Comprehensive reference for bone morphogenetic protein BMP-16, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-17
Comprehensive reference for bone morphogenetic protein BMP-17, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-2
Comprehensive reference for bone morphogenetic protein BMP-2, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-4
Comprehensive reference for bone morphogenetic protein BMP-4, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-5
Comprehensive reference for bone morphogenetic protein BMP-5, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-6
Comprehensive reference for bone morphogenetic protein BMP-6, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-7
Comprehensive reference for bone morphogenetic protein BMP-7, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-8a
Comprehensive reference for bone morphogenetic protein BMP-8a, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-8b
Comprehensive reference for bone morphogenetic protein BMP-8b, covering molecular structure, pharmacological properties, receptor interactions,
Bone Morphogenetic Protein BMP-9
Comprehensive reference for bone morphogenetic protein BMP-9, covering molecular structure, pharmacological properties, receptor interactions,
Bortezomib Proteasome Inhibition
Detailed mechanism of boronic acid dipeptide bortezomib inhibiting the 26S proteasome in multiple myeloma. This peptide or oligopeptide is studied for its bi...
Bortezomib: Oligopeptide Research Reference
Boronic acid proteasome inhibitor that blocks 26S proteasome activity, used for multiple myeloma and mantle cell lymphoma.
Bortezomib: Oligopeptide Research Reference
bortezomib in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Botulinum Neurotoxin (BoNT): Comprehensive Peptide Reference
Comprehensive reference for Botulinum Neurotoxin (BoNT), a peptide compound with applications in research and therapeutics.
Botulinum Neurotoxin (α-toxin / BoNT)
Comprehensive reference for Botulinum Neurotoxin (α-toxin / BoNT), a peptide compound with applications in research and therapeutics.
Botulinum Toxin A: Oligopeptide Research Reference
Botulinum Toxin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Botulinum Toxin B: Oligopeptide Research Reference
Botulinum Toxin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bovine Antimicrobial: Oligopeptide Research Reference
Bovine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Bovine Cathelicidin BMAP-28: Comprehensive Peptide Reference
Cathelicidin from bovine neutrophils with broad-spectrum antimicrobial properties. This antimicrobial peptide demonstrates activity against pathogens and is ...
Bowman-Birk Inhibitor: Oligopeptide Research Reference
Bowman-Birk Inhibitor, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Bradykinin → ACE (Substrate): Comprehensive Peptide Refer...
Comprehensive reference for Bradykinin → ACE (Substrate), a peptide compound with applications in research and therapeutics.
Bradykinin 1 7: Oligopeptide Research Reference
bradykinin 1 7 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Bradykinin Family Peptides: Comprehensive Peptide Reference
Overview of bradykinin and kallidin peptides in inflammation, pain, and vascular permeability. This peptide or oligopeptide is studied for its biological act...
Bradykinin: A Mediator of Inflammation and Vascular Tone
An exploration of bradykinin, a nonapeptide kinin that regulates vasodilation, inflammation, and pain signaling through B1 and B2 receptors.
BRAF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting BRAF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
Brain Derived Growth Factor 1-119
Comprehensive reference for brain derived growth factor 1-119, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor 1-30
Comprehensive reference for brain derived growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor 1-50
Comprehensive reference for brain derived growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor 1-70
Comprehensive reference for brain derived growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor 1-90
Comprehensive reference for brain derived growth factor 1-90, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor fragment-1-10
Comprehensive reference for brain derived growth factor fragment-1-10, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor fragment-20-50
Comprehensive reference for brain derived growth factor fragment-20-50, covering molecular structure, pharmacological properties, receptor interactions,
Brain Derived Growth Factor fragment-50-119
Comprehensive reference for brain derived growth factor fragment-50-119, covering molecular structure, pharmacological properties, receptor interactions,
Brain Natriuretic Peptide: Comprehensive Peptide Reference
Brain natriuretic peptide is a cardiac neurohormone that promotes natriuresis and vasodilation, serving as a critical biomarker and therapeutic target in hea...
Branched peptide: Oligopeptide Research Reference
Comprehensive reference for branched peptide, covering molecular structure, pharmacological properties, receptor interactions,
Branched System 1: Oligopeptide Research Reference
A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Branched System 2: Oligopeptide Research Reference
A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Branched System 3: Oligopeptide Research Reference
A branched-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Brazzein: Oligopeptide Research Reference
brazzein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Breast Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Breast Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...
Breast Cancer: Oligopeptide Research Reference
Malignant proliferation of breast epithelial cells. Most common cancer in women worldwide. Molecular subtypes: Luminal A (ER+/PR+/HER2-, best prognosis), Lum...
Bremelanotide: Oligopeptide Research Reference
Melanocortin MC4R agonist for hypoactive sexual desire disorder in premenopausal women. This peptide or oligopeptide is studied for its biological activity, ...
Brentuximab Vedotin: Oligopeptide Research Reference
Anti-CD30 antibody-drug conjugate with MMAE payload for Hodgkin lymphoma and anaplastic large cell lymphoma. This peptide or oligopeptide is studied for its ...
BRET for Peptides: Analytical Technique in Peptide Research
Application of BRET technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...
Brevinin 1e: Antimicrobial Peptide Reference
brevinin-1e is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Brevinin 1J: Antimicrobial Peptide Reference
brevinin-1J is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Brevinin 2e: Structure, Function, and Significance
Brevinin-2 peptides are shorter members of the brevinin family with enhanced selectivity for bacterial over mammalian membranes.
Brevinin 2Eb: Antimicrobial Peptide Reference
brevinin-2Eb is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...
Brevinin 2RTa: Antimicrobial Peptide Reference
brevinin-2RTa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...
Brevinin-1: Antimicrobial Peptide Reference
Amphibian antimicrobial peptide with potent activity against drug-resistant bacteria and anticancer properties. Covers molecular mechanisms, biological activ...
Brevinin-1: Antimicrobial Peptide Reference
Frog skin AMP with C-terminal cyclic heptapeptide disulfide bridge for bactericidal activity. This antimicrobial peptide demonstrates activity against pathog...
Brevinin-2: Antimicrobial Peptide Reference
Potent frog AMP with broader spectrum than brevinin-1 and activity against resistant bacteria. This antimicrobial peptide demonstrates activity against patho...
Brevinin: Structure, Function, and Significance
Brevinins are cyclic antimicrobial peptides from frog skin with a characteristic C-terminal ester bond creating a cyclic heptapeptide ring.
Brilacidin: Oligopeptide Research Reference
Brilacidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Broccoli Peptide: Oligopeptide Research Reference
A bioactive peptide derived from broccoli with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Bromoacetyl Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Bromoacetyl. This analytical technique provides valuable insights into peptide structure...
Brownian Dynamics for Peptides
A computational method for studying peptides using Brownian Dynamics. This analytical technique provides valuable insights into peptide structure, purity, an...
Bruker AVANCE III HD: Oligopeptide Research Reference
High-field NMR spectrometer (600-950 MHz) for protein structure determination. This peptide or oligopeptide is studied for its biological activity, structure...
Bruker timsTOF Pro 2: Oligopeptide Research Reference
Trapped ion mobility TOF mass spectrometer. High-resolution proteomics. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Bt Toxin Cry1Ab: Oligopeptide Research Reference
Bt toxin Cry1Ab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Bt Toxin Cry1Ac: Oligopeptide Research Reference
Bt toxin Cry1Ac in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Bt Toxin Cry2Ab: Oligopeptide Research Reference
Bt toxin Cry2Ab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Bt Toxin Vip3A: Oligopeptide Research Reference
Bt toxin Vip3A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
BT1718: Oligopeptide Research Reference
BT1718, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
BT5528: Oligopeptide Research Reference
BT5528, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Buccal Peptide Delivery: Oligopeptide Research Reference
Buccal adhesive systems for sustained peptide delivery through cheek mucosa. This peptide or oligopeptide is studied for its biological activity, structure-a...
Buprenorphine Partial Agonist: Comprehensive Peptide Refe...
Semi-synthetic partial mu-agonist and kappa-antagonist for addiction treatment. This neuropeptide is involved in neurological signaling and is studied for it...
Buprenorphine: Oligopeptide Research Reference
Buprenorphine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
buried-surface-area Resource: Comprehensive Peptide Refer...
The buried-surface-area database or resource for peptide research, providing data on structure, function, and interactions.
Bursicon: Oligopeptide Research Reference
Bursicon, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Buserelin: Oligopeptide Research Reference
Potent GnRH agonist with D-Ser(tBu) modification for nasal and subcutaneous administration. This peptide or oligopeptide is studied for its biological activi...
Buserelin: Oligopeptide Research Reference
buserelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
By Monitoring Frequency: Oligopeptide Research Reference
By Monitoring Frequency, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Regulatory Burden: Oligopeptide Research Reference
By Regulatory Burden, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Severity: Oligopeptide Research Reference
By Severity, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
C Botulinum Peptide: Oligopeptide Research Reference
A peptide associated with C Botulinum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
C Difficile Peptide: Oligopeptide Research Reference
A peptide associated with C Difficile for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
C Diphtheriae Peptide: Oligopeptide Research Reference
A peptide associated with C Diphtheriae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
C Jejuni Peptide: Oligopeptide Research Reference
A peptide associated with C Jejuni for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
C MET Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting C MET Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
C MET Inhibitor: Oligopeptide Research Reference
c MET inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
C Myc Tag Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using C Myc Tag. This analytical technique provides valuable insights into peptide structure, ...
C Perfringens Peptide: Oligopeptide Research Reference
A peptide associated with C Perfringens for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
C Terminal Mod System 1: Oligopeptide Research Reference
A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
C Terminal Mod System 2: Oligopeptide Research Reference
A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
C Terminal Mod System 3: Oligopeptide Research Reference
A C-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
C Tetani Peptide: Oligopeptide Research Reference
A peptide associated with C Tetani for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
C Trachomatis Peptide: Oligopeptide Research Reference
A peptide associated with C Trachomatis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
C-Peptide Relationship: Oligopeptide Research Reference
Equimolar production of C-peptide with insulin from proinsulin cleavage as endogenous secretion marker. This peptide or oligopeptide is studied for its biolo...
C-Peptide: Oligopeptide Research Reference
31-amino acid connecting peptide cleaved from proinsulin, used as a marker of endogenous insulin secretion. This peptide or oligopeptide is studied for its b...
C-Terminal Amidation: Oligopeptide Research Reference
Addition of amide group at C-terminus. Protects against exopeptidase degradation. This peptide or oligopeptide is studied for its biological activity, struct...
C-Terminal PEGylation: Post-Translational Modification Re...
C-Terminal PEGylation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CA 15-3: Peptide Fragment Reference
MUC1 glycoprotein. Breast cancer biomarker for treatment monitoring. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
CA 19-9: Peptide Fragment Reference
Sialyl-Lewis(a) carbohydrate antigen (CA 19-9). Elevated in pancreatic cancer (80%), bile duct cancer, gastric cancer. Normal: <37 U/mL. Used for monitoring ...
CA-125 (MUC16): Oligopeptide Research Reference
MUC16 gene product, ~3.5 MDa transmembrane glycoprotein. Overexpressed in ovarian epithelial cancer. Normal: <35 U/mL. Used for monitoring ovarian cancer tre...
CA-125 (MUC16): Oligopeptide Research Reference
Mucin-type glycoprotein, overexpressed in ovarian cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...
Cabbage Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cabbage with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Caerulein: Antimicrobial Peptide Reference
Caerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Calciseptine: Structure, Function, and Significance
Calciseptine from black mamba venom blocks L-type calcium channels, causing hypotension and bradycardia. This peptide or oligopeptide is studied for its biol...
Calcitonin amylin-1-37: Endogenous Peptide Hormone Reference
Comprehensive reference for calcitonin amylin-1-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin bovine-1-32: Endogenous Peptide Hormone Reference
Comprehensive reference for calcitonin bovine-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin eel-1-32: Endogenous Peptide Hormone Reference
Comprehensive reference for calcitonin eel-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin Family Peptides: Comprehensive Peptide Reference
Learn about calcitonin, amylin, and CGRP in the calcitonin peptide family and their metabolic roles. This peptide or oligopeptide is studied for its biologic...
Calcitonin fragment-1-7: Endogenous Peptide Hormone Refer...
Comprehensive reference for calcitonin fragment-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin fragment-16-22: Comprehensive Peptide Reference
Comprehensive reference for calcitonin fragment-16-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin fragment-23-32: Comprehensive Peptide Reference
Comprehensive reference for calcitonin fragment-23-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin fragment-8-15: Endogenous Peptide Hormone Refe...
Comprehensive reference for calcitonin fragment-8-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin Gene Related: Neuropeptide in Neuroscience Ref...
calcitonin-gene-related is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. Covers molecular mechanisms, biological act...
Calcitonin Gene-Related Peptide
37-amino acid neuropeptide potent vasodilator involved in migraine pathophysiology and pain signaling. This peptide or oligopeptide is studied for its biolog...
Calcitonin Hormone: Endogenous Peptide Hormone Reference
Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Calcitonin human-1-32: Endogenous Peptide Hormone Reference
Comprehensive reference for calcitonin human-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin Peptide Hormone: Comprehensive Peptide Reference
Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Calcitonin porcine-1-32: Endogenous Peptide Hormone Refer...
Comprehensive reference for calcitonin porcine-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin Protein Hormone: Comprehensive Peptide Reference
Calcitonin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Calcitonin salmon-1-32: Endogenous Peptide Hormone Reference
Comprehensive reference for calcitonin salmon-1-32 variant, covering molecular structure, pharmacological properties, receptor interactions,
Calcitonin Salmon: Oligopeptide Research Reference
Synthetic salmon calcitonin for osteoporosis and Paget's disease, inhibiting osteoclast-mediated bone resorption. Covers molecular mechanisms, biological act...
Calcitonin Salmon: Oligopeptide Research Reference
calcitonin salmon in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Calcitonin: Oligopeptide Research Reference
Calcitonin is a 32-amino acid peptide hormone produced by thyroid C cells that regulates calcium homeostasis and serves as a therapeutic agent for osteoporos...
Calpain Inhibitor: Enzyme in Peptide Biology Reference
calpain inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate speci...
Calprotectin (S100A8/A9): Oligopeptide Research Reference
S100A8 (8.5 kDa, 93 aa) + S100A9 (12.4 kDa, 114 aa) heterodimer. Neutrophil-derived calcium-binding protein comprising ~40% of cytosolic protein in neutrophi...
CaMK Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
CaMK Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
CaMK Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
CaMK Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
CaMK Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the CaMK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Cancer / HPV-Associated: Oligopeptide Research Reference
Cancer / HPV-Associated is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...
Cancer / Immune Modulatory: Comprehensive Peptide Reference
Cancer / Immune Modulatory is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...
Cancer / Personalized Neoantigen
Cancer / Personalized Neoantigen is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...
Cancer and Peptides: Oligopeptide Research Reference
Learn about peptide-based cancer therapies including targeted drug conjugates, immunomodulatory peptides, and tumor-homing peptides.
Cancer Immunotherapy Peptides: Neoantigen Vaccines and Ch...
Explore peptide-based cancer immunotherapy approaches including personalized neoantigen vaccines and checkpoint inhibitor peptidomimetics.
Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Cancer Treatment: Oligopeptide Research Reference
Multimodal approach: surgery (local control), radiation therapy (local control), chemotherapy (systemic cytotoxic), targeted therapy (molecular targets), imm...
Cancer: Oligopeptide Research Reference
Screening, monitoring, recurrence detection. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Candida albicans target: Oligopeptide Research Reference
Binds Ssa1p on candida surface, induces ROS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Candida glabrata: Oligopeptide Research Reference
Disrupts cell wall integrity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Canine Antimicrobial: Oligopeptide Research Reference
Canine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Canine Beta-Defensin: Oligopeptide Research Reference
Canine Beta-Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Canine Defensin: Oligopeptide Research Reference
Canine Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Canine Neutrophil Peptide: Comprehensive Peptide Reference
Comprehensive reference for Canine Neutrophil Peptide, a peptide compound with applications in research and therapeutics.
Canine Serum Peptide: Oligopeptide Research Reference
Canine Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Capillary Electrophoresis Analysis
An analytical technique for characterizing peptides using Capillary Electrophoresis. This analytical technique provides valuable insights into peptide struct...
Capillary Electrophoresis for Peptides
Explore capillary electrophoresis techniques for high-resolution separation and analysis of peptide mixtures. This peptide or oligopeptide is studied for its...
Capreomycin: Oligopeptide Research Reference
Capreomycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Captopril: Oligopeptide Research Reference
First oral ACE inhibitor derived from Brazilian pit viper venom, containing a thiol group for angiotensin-converting enzyme inhibition.
Captopril: Oligopeptide Research Reference
Captopril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Car T Target BCMA: Oligopeptide Research Reference
Comprehensive reference for car t target BCMA, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD123: Oligopeptide Research Reference
Comprehensive reference for car t target CD123, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD133: Oligopeptide Research Reference
Comprehensive reference for car t target CD133, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD138: Oligopeptide Research Reference
Comprehensive reference for car t target CD138, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD19: Oligopeptide Research Reference
Comprehensive reference for car t target CD19, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD20: Oligopeptide Research Reference
Comprehensive reference for car t target CD20, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD22: Oligopeptide Research Reference
Comprehensive reference for car t target CD22, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD30: Oligopeptide Research Reference
Comprehensive reference for car t target CD30, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD33: Oligopeptide Research Reference
Comprehensive reference for car t target CD33, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD38: Oligopeptide Research Reference
Comprehensive reference for car t target CD38, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD44: Oligopeptide Research Reference
Comprehensive reference for car t target CD44, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD5: Oligopeptide Research Reference
Comprehensive reference for car t target CD5, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD7: Oligopeptide Research Reference
Comprehensive reference for car t target CD7, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target CD70: Oligopeptide Research Reference
Comprehensive reference for car t target CD70, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target Claudin18.2: Oligopeptide Research Reference
Comprehensive reference for car t target Claudin18.2, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target EGFR: Oligopeptide Research Reference
Comprehensive reference for car t target EGFR, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target GPC3: Oligopeptide Research Reference
Comprehensive reference for car t target GPC3, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target HER2: Oligopeptide Research Reference
Comprehensive reference for car t target HER2, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target Mesothelin: Oligopeptide Research Reference
Comprehensive reference for car t target Mesothelin, covering molecular structure, pharmacological properties, receptor interactions,
Car T Target NKG2D: Oligopeptide Research Reference
Comprehensive reference for car t target NKG2D, covering molecular structure, pharmacological properties, receptor interactions,
Carbetocin: Oligopeptide Research Reference
Long-acting oxytocin analog for postpartum hemorrhage prevention with D-Tyr substitution. This peptide or oligopeptide is studied for its biological activity...
Carbohydrate Conjugate System 1
A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Carbohydrate Conjugate System 2
A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Carbohydrate Conjugate System 3
A carbohydrate-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Carbohydrate Conjugation Synthesis
A peptide synthesis method using Carbohydrate Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...
Carcinoma Peptides: Oligopeptide Research Reference
Peptides associated with Carcinoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...
Cardiac Troponin I: Oligopeptide Research Reference
209-aa regulatory protein of cardiac muscle thin filament. Cardiac-specific isoform (cTnI) encoded by TNNI3 gene. Released upon myocardial cell death. Normal...
Cardiac Troponin T: Oligopeptide Research Reference
298-aa structural protein of cardiac muscle thin filament. Cardiac-specific isoform (cTnT) encoded by TNNT2 gene. Released upon myocardial injury. Normal: <1...
Cardiac: Oligopeptide Research Reference
MI diagnosis, HF assessment, coagulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Cardiomyopathy: Oligopeptide Research Reference
Disease of the heart muscle leading to impaired cardiac function. Types: dilated (DCM), hypertrophic (HCM), restrictive (RCM), arrhythmogenic (ARVC). Treatme...
Cardiotoxicity: Oligopeptide Research Reference
Heart damage caused by peptide drugs. Can include arrhythmias and cardiomyopathy. This peptide or oligopeptide is studied for its biological activity, struct...
Cardiovascular / ACE Inhibitor (peptide-derived)
Cardiovascular / ACE Inhibitor (peptide-derived) is a bioactive compound with applications in peptide research and therapeutics.
Cardiovascular / Anticoagulant
Cardiovascular / Anticoagulant is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...
Cardiovascular / Anticoagulant Peptide
Cardiovascular / Anticoagulant Peptide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologica...
Cardiovascular / Kinin System: Comprehensive Peptide Refe...
Cardiovascular / Kinin System is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Cardiovascular Disease: Oligopeptide Research Reference
Diseases of the heart and blood vessels: coronary artery disease, heart failure, arrhythmias, hypertension, peripheral vascular disease. Leading cause of dea...
Cardiovascular Peptides: Oligopeptide Research Reference
Peptides associated with Cardiovascular including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...
Cardiovascular: Oligopeptide Research Reference
Natriuretic peptides, troponins, coagulation factors. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...
Carfentanil Veterinary: Neuropeptide in Neuroscience Refe...
Most potent commercially available synthetic opioid for large animal use. This neuropeptide is involved in neurological signaling and is studied for its role...
Carfilzomib Proteasome Inhibitor
Irreversible epoxyketone proteasome inhibitor derived from natural product epoxomicin for multiple myeloma treatment. Covers molecular mechanisms, biological...
Carfilzomib: Oligopeptide Research Reference
Epoxyketone proteasome inhibitor that irreversibly inhibits the 20S proteasome for relapsed multiple myeloma. This peptide or oligopeptide is studied for its...
Carnosine Analog: Oligopeptide Research Reference
carnosine analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Carnosine: Short Peptide in Biochemistry Reference
Carnosine is a naturally occurring dipeptide composed of beta-alanine and L-histidine, functioning as an intracellular pH buffer, antioxidant, and anti-glyca...
Carp NPY: Oligopeptide Research Reference
Carp NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Carperitide: Oligopeptide Research Reference
Recombinant human atrial natriuretic peptide used in Japan for acute decompensated heart failure. This peptide or oligopeptide is studied for its biological ...
Carrot Peptide: Oligopeptide Research Reference
A bioactive peptide derived from carrot with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Cashew Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cashew with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Casimersen: Oligopeptide Research Reference
Casimersen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Casocidin: Oligopeptide Research Reference
Casocidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Casokinin 1: Oligopeptide Research Reference
casokinin-1 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Casokinin 2: Oligopeptide Research Reference
casokinin-2 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Casokinin: Structure, Function, and Significance
Casokinins are ACE-inhibitory peptides derived from casein during digestion. They contribute to the antihypertensive effects of milk.
Casomorphin: Oligopeptide Research Reference
Opioid peptides derived from casein (milk protein). β-casomorphin-7 (Tyr-Pro-Phe-Pro-Gly-Pro-Ile) is most studied. Activates mu-opioid receptors. May affect ...
Casoxin C: Oligopeptide Research Reference
Casein-derived opioid antagonist. Found in milk protein digests. May counteract casomorphin effects. Part of the endogenous opioid balance in milk consumption.
Caspofungin: Oligopeptide Research Reference
Echinocandin antifungal that inhibits beta-1,3-D-glucan synthase, disrupting fungal cell wall integrity in Candida and Aspergillus.
Caspofungin: Oligopeptide Research Reference
Echinocandin antifungal inhibiting beta-1,3-glucan synthase for invasive candidiasis. This peptide or oligopeptide is studied for its biological activity, st...
Caspofungin: Oligopeptide Research Reference
caspofungin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Casting Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Casting for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...
Cat-PAD: Oligopeptide Research Reference
Cat-PAD, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Catalase Mimetic: Oligopeptide Research Reference
catalase mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Category: Oligopeptide Research Reference
Primary Activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
CATH Resource: Oligopeptide Research Reference
The CATH database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
Cathelicidin FF-16: Antimicrobial Peptide Reference
Short synthetic antimicrobial peptide from LL-37 with potent bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is...
Cathelicidin KR-12: Antimicrobial Peptide Reference
Minimum active antimicrobial fragment of LL-37 with reduced cytotoxicity. This antimicrobial peptide demonstrates activity against pathogens and is studied f...
Cathelicidin LL-37: Antimicrobial Peptide Reference
Only human cathelicidin with broad-spectrum antimicrobial and immunomodulatory properties. This antimicrobial peptide demonstrates activity against pathogens...
Cathepsin Inhibitor: Enzyme in Peptide Biology Reference
cathepsin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spe...
Cauliflower Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cauliflower with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-a...
CBD Tag Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using CBD Tag. This analytical technique provides valuable insights into peptide structure, pu...
CCK 10: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 10 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 11: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 11 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 12: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 12 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 14: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 14 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 22: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 22 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 25: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 25 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 33: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 33 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 4: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 4 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 5: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 5 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 58: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 58 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 6: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 6 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 65: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 65 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 7: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 7 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 70: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 70 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 83: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 83 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK 9: Neuropeptide in Neuroscience Reference
Comprehensive reference for CCK 9 variant, covering molecular structure, pharmacological properties, receptor interactions,
CCK Anxiety: Neuropeptide in Neuroscience Reference
Central CCK effects on anxiety and panic through CCK-B receptors. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...
CCK Hormone: Endogenous Peptide Hormone Reference
CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CCK Peptide Hormone: Endogenous Peptide Hormone Reference
CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CCK Protein Hormone: Endogenous Peptide Hormone Reference
CCK, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CCK-8 (Sulfated): Neuropeptide in Neuroscience Reference
CCK-8 (Sulfated), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CD Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using CD. This analytical technique provides valuable insights into peptide structure, purity, and charac...
CD-spectroscopy for Peptides: Comprehensive Peptide Refer...
Application of CD-spectroscopy technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...
CD200 Agonist: Oligopeptide Research Reference
CD200 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
CD27 Agonist: Oligopeptide Research Reference
CD27 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
CD28 Agonist: Oligopeptide Research Reference
CD28 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
CD40 Agonist: Oligopeptide Research Reference
CD40 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
CD47 Blocker: Oligopeptide Research Reference
CD47 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
CE MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using CE MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...
CE-align Resource: Oligopeptide Research Reference
The CE-align database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
CEA: Oligopeptide Research Reference
184 kDa glycosylated cell adhesion molecule. Overexpressed in adenocarcinomas (colorectal, pancreatic, gastric, lung). Normal: <2.5 ng/mL (non-smokers), <5.0...
Cecropin / Antimicrobial: Oligopeptide Research Reference
Cecropin / Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Cecropin A (Hyalophora): Oligopeptide Research Reference
Cecropin A (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cecropin A: Antimicrobial Peptide Reference
Insect antimicrobial peptide from the cecropia moth that pioneered innate immunity research and inspired peptide antibiotic development.
Cecropin A: Antimicrobial Peptide Reference
Cationic alpha-helical AMP from giant silk moth with gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens ...
Cecropin AD (Hybrid): Oligopeptide Research Reference
Cecropin AD (Hybrid), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cecropin B (Hyalophora): Oligopeptide Research Reference
Cecropin B (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cecropin B: Antimicrobial Peptide Reference
AMP from Hyalophora cecropia with potent gram-negative and some antifungal activity. This antimicrobial peptide demonstrates activity against pathogens and i...
Cecropin D (Hyalophora): Oligopeptide Research Reference
Cecropin D (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cecropin P1 (Sus scrofa): Oligopeptide Research Reference
Comprehensive reference for Cecropin P1 (Sus scrofa), a peptide compound with applications in research and therapeutics.
Cecropin P1: Antimicrobial Peptide Reference
AMP from pig intestine with broad-spectrum activity against enteric pathogens. This antimicrobial peptide demonstrates activity against pathogens and is stud...
Cecropin-Drosomycin Hybrid: Comprehensive Peptide Reference
Engineered hybrid combining cecropin and drosomycin for dual activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...
Cecropin: Antimicrobial Peptide Reference
A family of antibacterial peptides first isolated from the giant silk moth Hyalophora cecropia, characterized by their linear structure and potent activity a...
Cecropins: Oligopeptide Research Reference
Broad-spectrum antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Ceftazidime/Avibactam: Oligopeptide Research Reference
Ceftazidime/Avibactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Celery Peptide: Oligopeptide Research Reference
A bioactive peptide derived from celery with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Celiac Peptides: Oligopeptide Research Reference
Peptides associated with Celiac including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Cell adhesion: Oligopeptide Research Reference
Comprehensive reference for cell adhesion, covering molecular structure, pharmacological properties, receptor interactions,
Cell Free Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Cell Free for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Cell migration: Oligopeptide Research Reference
Comprehensive reference for cell migration, covering molecular structure, pharmacological properties, receptor interactions,
Cell signaling: Oligopeptide Research Reference
Comprehensive reference for cell signaling, covering molecular structure, pharmacological properties, receptor interactions,
Cell Sorting Analysis: Analytical Technique in Peptide Re...
An analytical technique for characterizing peptides using Cell Sorting. This analytical technique provides valuable insights into peptide structure, purity, ...
Cell-Free Protein Synthesis: Comprehensive Peptide Reference
In vitro transcription/translation using cell extracts. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Cell-Penetrating Peptides for Delivery
Explore CPP-mediated intracellular delivery of cargo peptides across cell membranes. This peptide or oligopeptide is studied for its biological activity, str...
Cell-Penetrating Peptides: Comprehensive Peptide Reference
Peptides that can cross cell membranes. Used for intracellular drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Cemiplimab: Oligopeptide Research Reference
cemiplimab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Centrifugal Separation Purification
A purification technique for separating and isolating peptides using Centrifugal Separation. This analytical technique provides valuable insights into peptid...
Centrifugal Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using Centrifugal for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
centrifugation for Peptides: Comprehensive Peptide Reference
Application of centrifugation technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Cephalosporin: Oligopeptide Research Reference
Cephalosporin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cerliponase Alfa: Oligopeptide Research Reference
Cerliponase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Certolizumab: Oligopeptide Research Reference
certolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Cerulein: Antimicrobial Peptide Reference
Cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cervical Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Cervical Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...
Cetrorelix: Oligopeptide Research Reference
Injectable GnRH antagonist used in IVF protocols to prevent premature ovulation and in prostate cancer treatment. Covers molecular mechanisms, biological act...
Cetrorelix: Oligopeptide Research Reference
cetrorelix in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Cetuximab: Oligopeptide Research Reference
cetuximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Ceyciganin 1: Oligopeptide Research Reference
ceyciganin-1 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.
Ceyciganin 2: Oligopeptide Research Reference
ceyciganin-2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.
CgA (Conus geographus): Oligopeptide Research Reference
CgA (Conus geographus), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CGRP → CGRP Receptor: Oligopeptide Research Reference
CGRP → CGRP Receptor, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CGRP 22-37: Peptide Fragment Reference
Comprehensive reference for CGRP 22-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
CGRP 8-37: Peptide Fragment Reference
Comprehensive reference for CGRP 8-37 variant, covering molecular structure, pharmacological properties, receptor interactions,
CGRP Alpha: Neuropeptide in Neuroscience Reference
Calcitonin gene-related peptide mediating vasodilation and pain transmission in trigeminal system. This neuropeptide is involved in neurological signaling an...
CGRP Beta: Neuropeptide in Neuroscience Reference
Beta isoform of CGRP with similar vasodilatory and neuromodulatory functions. This neuropeptide is involved in neurological signaling and is studied for its ...
CGRP Family Peptides: Oligopeptide Research Reference
Explore calcitonin gene-related peptide family in migraine pathophysiology and vascular biology. This peptide or oligopeptide is studied for its biological a...
CGRP Fragment: Oligopeptide Research Reference
CGRP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
CGRP Hormone: Endogenous Peptide Hormone Reference
CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CGRP in Migraine: Oligopeptide Research Reference
An analysis of the calcitonin gene-related peptide pathway in migraine pathophysiology, including monoclonal antibody therapies and small-molecule gepants ta...
CGRP Peptide Hormone: Endogenous Peptide Hormone Reference
CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CGRP Protein Hormone: Endogenous Peptide Hormone Reference
CGRP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CGRP Receptor Pharmacology: Comprehensive Peptide Reference
Molecular pharmacology of CGRP receptor including RAMP1 interaction and signal transduction. This peptide or oligopeptide is studied for its biological activ...
CGRP(28 37): Neuropeptide in Neuroscience Reference
CGRP(28-37) is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...
CGRP8 37: Neuropeptide in Neuroscience Reference
CGRP8-37 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This neuropeptide is involved in neurological signaling an...
Chameleon Cathelicidin: Oligopeptide Research Reference
Chameleon Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chameleon Chromatophore Regulatory Peptide
Comprehensive reference for Chameleon Chromatophore Regulatory Peptide, a peptide compound with applications in research and therapeutics.
Chameleon Color-Change Peptide
Comprehensive reference for Chameleon Color-Change Peptide, a peptide compound with applications in research and therapeutics.
Chameleon Defensin: Oligopeptide Research Reference
Chameleon Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chameleon Peptides: Oligopeptide Research Reference
Antimicrobial, Pigmentation, Drug Discovery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Chameleon Skin Peptide: Oligopeptide Research Reference
Chameleon Skin Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chameleon Venom Peptide: Oligopeptide Research Reference
Chameleon Venom Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Characterization (5 processes)
Comprehensive reference for Characterization (5 processes), a peptide compound with applications in research and therapeutics.
Charybdopsis: Peptide Toxin in Pharmacology Reference
Charybdopsis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Charybdotoxin: Peptide Toxin in Pharmacology Reference
Potassium channel blocker from scorpion venom with broad Kv channel activity. This peptide toxin is derived from venom and studied for its pharmacological ac...
Checkpoint Inhibitor 4-1BB-4-1BBL
Comprehensive reference for checkpoint inhibitor 4-1BB-4-1BBL, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor 4-1BB: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor 4-1BB, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H3-4Ig
Comprehensive reference for checkpoint inhibitor B7-H3-4Ig, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H3-antibody
Comprehensive reference for checkpoint inhibitor B7-H3-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H3: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor B7-H3, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H4-antibody
Comprehensive reference for checkpoint inhibitor B7-H4-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H4-VTCN
Comprehensive reference for checkpoint inhibitor B7-H4-VTCN, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor B7-H4: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor B7-H4, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD200-CD200R
Comprehensive reference for checkpoint inhibitor CD200-CD200R, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD200: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CD200, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD27-CD70
Comprehensive reference for checkpoint inhibitor CD27-CD70, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD27: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CD27, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD28-B7: Comprehensive Peptide Refer...
Comprehensive reference for checkpoint inhibitor CD28-B7, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD28: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CD28, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD40-CD40L
Comprehensive reference for checkpoint inhibitor CD40-CD40L, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD40: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CD40, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CD47: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CD47, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor Conjugates
Comprehensive reference for Checkpoint Inhibitor Conjugates, a peptide compound with applications in research and therapeutics.
Checkpoint Inhibitor CTLA-4-antibody
Comprehensive reference for checkpoint inhibitor CTLA-4-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CTLA-4-B7
Comprehensive reference for checkpoint inhibitor CTLA-4-B7, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor CTLA-4: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor CTLA-4, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor FcRn-IgG: Comprehensive Peptide Refe...
Comprehensive reference for checkpoint inhibitor FcRn-IgG, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor FcRn: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor FcRn, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor ICOS-ICOSL
Comprehensive reference for checkpoint inhibitor ICOS-ICOSL, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor ICOS: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor ICOS, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor LAG-3-antibody
Comprehensive reference for checkpoint inhibitor LAG-3-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor LAG-3-MHC
Comprehensive reference for checkpoint inhibitor LAG-3-MHC, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor LAG-3: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor LAG-3, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor OX40-OX40L
Comprehensive reference for checkpoint inhibitor OX40-OX40L, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor OX40: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor OX40, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor PD-1-PD-L1
Comprehensive reference for checkpoint inhibitor PD-1-PD-L1, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor PD-1-PD-L1-antibody
Comprehensive reference for checkpoint inhibitor PD-1-PD-L1-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor PD-1: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor PD-1, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor PD-L1: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor PD-L1, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor SIRP-alpha
Comprehensive reference for checkpoint inhibitor SIRP-alpha, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor SIRP-alpha-CD47
Comprehensive reference for checkpoint inhibitor SIRP-alpha-CD47, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIGIT-antibody
Comprehensive reference for checkpoint inhibitor TIGIT-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIGIT-CD155
Comprehensive reference for checkpoint inhibitor TIGIT-CD155, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIGIT: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor TIGIT, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIM-3-antibody
Comprehensive reference for checkpoint inhibitor TIM-3-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIM-3-Galectin
Comprehensive reference for checkpoint inhibitor TIM-3-Galectin, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor TIM-3: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor TIM-3, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor VISTA-antibody
Comprehensive reference for checkpoint inhibitor VISTA-antibody, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor VISTA-B7-H1
Comprehensive reference for checkpoint inhibitor VISTA-B7-H1, covering molecular structure, pharmacological properties, receptor interactions,
Checkpoint Inhibitor VISTA: Comprehensive Peptide Reference
Comprehensive reference for checkpoint inhibitor VISTA, covering molecular structure, pharmacological properties, receptor interactions,
ChEMBL: Oligopeptide Research Reference
Chemical database of bioactive molecules with drug-like properties. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Chemical Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Chemical for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...
Chemiluminescent immunoassay: Comprehensive Peptide Refer...
High-throughput clinical. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Chemokine CCL1: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL1, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL11: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL11, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL13: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL13, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL14: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL14, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL17: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL17, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL18: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL18, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL19: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL19, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL2: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL2, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL20: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL20, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL21: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL21, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL22: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL22, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL24: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL24, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL25: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL25, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL26: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL26, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL27: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL27, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL3: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL3, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL4: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL4, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL5: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL5, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL7: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL7, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CCL8: Oligopeptide Research Reference
Comprehensive reference for chemokine CCL8, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CX3CL1: Oligopeptide Research Reference
Comprehensive reference for chemokine CX3CL1, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL1: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL1, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL10: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL10, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL11: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL11, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL12: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL12, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL13: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL13, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL14: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL14, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL16: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL16, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL17: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL17, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL2: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL2, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL3: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL3, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL5: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL5, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL6: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL6, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL8: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL8, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine CXCL9: Oligopeptide Research Reference
Comprehensive reference for chemokine CXCL9, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine XCL1: Oligopeptide Research Reference
Comprehensive reference for chemokine XCL1, covering molecular structure, pharmacological properties, receptor interactions,
Chemokine XCL2: Oligopeptide Research Reference
Comprehensive reference for chemokine XCL2, covering molecular structure, pharmacological properties, receptor interactions,
Cherry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cherry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Chi-Conotoxin TxIA: Peptide Toxin in Pharmacology Reference
Acetylcholine release inhibitor from Conus textile blocking presynaptic channels. This peptide toxin is derived from venom and studied for its pharmacologica...
Chia Peptide: Oligopeptide Research Reference
A bioactive peptide derived from chia with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Chicken Avian Beta-Defensin (General)
Comprehensive reference for Chicken Avian Beta-Defensin (General), a peptide compound with applications in research and therapeutics.
Chicken Calcitonin: Oligopeptide Research Reference
32-aa hormone from chicken parafollicular C-cells. Regulates calcium metabolism. This peptide or oligopeptide is studied for its biological activity, structu...
Chicken Cathelicidin-1 (CATH-1)
Comprehensive reference for Chicken Cathelicidin-1 (CATH-1), a peptide compound with applications in research and therapeutics.
Chicken Cathelicidin: Oligopeptide Research Reference
Chicken Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chicken Galanin: Oligopeptide Research Reference
Galanin neuropeptide from chicken brain. Roles in feeding behavior and neuroendocrine regulation. This peptide or oligopeptide is studied for its biological ...
Chicken GH: Oligopeptide Research Reference
Growth hormone from chicken pituitary. 191-aa protein regulating growth and metabolism in avian species. This peptide or oligopeptide is studied for its biol...
Chicken Glucagon: Oligopeptide Research Reference
29-aa hormone from chicken pancreas. Regulates glucose metabolism. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Chicken GnRH: Oligopeptide Research Reference
Chicken GnRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chicken Growth Hormone (cGH): Comprehensive Peptide Refer...
Comprehensive reference for Chicken Growth Hormone (cGH), a peptide compound with applications in research and therapeutics.
Chicken Insulin: Oligopeptide Research Reference
Insulin from chicken pancreas. Highly conserved with mammalian insulin. Used in comparative endocrinology research. Covers molecular mechanisms, biological a...
Chicken Lysozyme: Oligopeptide Research Reference
129-aa enzyme from chicken egg white. Hydrolyzes bacterial cell wall peptidoglycan. This peptide or oligopeptide is studied for its biological activity, stru...
Chicken Neuropeptide Y (cNPY): Comprehensive Peptide Refe...
Comprehensive reference for Chicken Neuropeptide Y (cNPY), a peptide compound with applications in research and therapeutics.
Chicken NPY: Oligopeptide Research Reference
NPY from chicken brain. Regulates feeding behavior in poultry. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Chicken Ovotransferrin (Conalbumin)
Comprehensive reference for Chicken Ovotransferrin (Conalbumin), a peptide compound with applications in research and therapeutics.
Chicken Ovotransferrin: Oligopeptide Research Reference
686-aa iron-binding glycoprotein from chicken egg white. Antimicrobial via iron sequestration. This peptide or oligopeptide is studied for its biological act...
Chicken PACAP: Oligopeptide Research Reference
Chicken PACAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chicken Parathyroid Hormone (cPTH)
Comprehensive reference for Chicken Parathyroid Hormone (cPTH), a peptide compound with applications in research and therapeutics.
Chicken PTH: Oligopeptide Research Reference
Parathyroid hormone from chicken parathyroid glands. Regulates calcium homeostasis in avian species. This peptide or oligopeptide is studied for its biologic...
Chicken Vasoactive Intestinal Peptide (cVIP)
Comprehensive reference for Chicken Vasoactive Intestinal Peptide (cVIP), a peptide compound with applications in research and therapeutics.
Chicken VIP: Oligopeptide Research Reference
VIP from chicken intestine. Regulates GI function and vasodilation. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Chickpea Peptide: Oligopeptide Research Reference
A bioactive peptide derived from chickpea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
ChimeraX: Oligopeptide Research Reference
Molecular visualization program for macromolecular structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Chitinase Plant: Oligopeptide Research Reference
chitinase plant in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Chitosan Nanoparticles Oral: Comprehensive Peptide Reference
Chitosan-based nanoparticles enhancing oral peptide bioavailability through mucoadhesion. This peptide or oligopeptide is studied for its biological activity...
Chitosan Peptides: Oligopeptide Research Reference
Chitosan Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chloroeremomycin: Antimicrobial Peptide Reference
Glycopeptide antibiotic precursor to oritavancin, produced by Amycolatopsis orientalis with activity against vancomycin-resistant organisms.
Chlorotoxin: Peptide Toxin in Pharmacology Reference
Chlorotoxin is a 36-amino acid peptide from deathstalker scorpion venom that binds specifically to glioma cells and matrix metalloproteinase-2, used as a tum...
Cholecystokinin Family Peptides
Guide to CCK family peptides in digestion, satiety signaling, and neurotransmission. This peptide or oligopeptide is studied for its biological activity, str...
Cholecystokinin Receptor Pharmacology
Molecular pharmacology and clinical significance of cholecystokinin-A (CCK-A) and cholecystokinin-B (CCK-B) receptors in satiety, anxiety, and gastrointestin...
Cholecystokinin-8: Oligopeptide Research Reference
CCK-8 is the eight-amino acid bioactive fragment of cholecystokinin responsible for satiety signaling, pancreatic enzyme secretion, and gallbladder contraction.
Cholecystokinin: Neuropeptide in Neuroscience Reference
A gastrointestinal neuropeptide that stimulates gallbladder contraction, pancreatic enzyme secretion, and appetite suppression, existing in multiple isoforms...
CHR-021: Oligopeptide Research Reference
Molecular weight, sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
CHR-022: Oligopeptide Research Reference
Composition, quantification. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
CHR-023: Oligopeptide Research Reference
Stereochemistry, conformation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
CHR-024: Oligopeptide Research Reference
Secondary structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
CHR-025: Oligopeptide Research Reference
3D atomic structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Chromatin remodeling: Oligopeptide Research Reference
Comprehensive reference for chromatin remodeling, covering molecular structure, pharmacological properties, receptor interactions,
Chromatographic Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Chromatographic for producing peptides with specific properties. This analytical technique provides valuable insights into p...
chromatography for Peptides: Comprehensive Peptide Reference
Application of chromatography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Chromogranin A (CgA): Oligopeptide Research Reference
Chromogranin A (CgA), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chromogranin A: Oligopeptide Research Reference
439-aa acidic secretory protein co-secreted with catecholamines from neurosecretory granules (chromaffin cells, enterochromaffin-like cells). Marker of neuro...
Chronic Pain Peptides: Oligopeptide Research Reference
Peptides associated with Chronic Pain including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Chrysophsin 1: Oligopeptide Research Reference
Chrysophsin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chrysophsin 2: Oligopeptide Research Reference
Chrysophsin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chrysophsin 3: Oligopeptide Research Reference
Chrysophsin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Chrysophsin: Antimicrobial Peptide Reference
chrysophsin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Chymotrypsin Inhibitor (Barley)
Comprehensive reference for Chymotrypsin Inhibitor (Barley), a peptide compound with applications in research and therapeutics.
Ciguatoxin: Oligopeptide Research Reference
Ciguatoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cilengitide: Oligopeptide Research Reference
Cilengitide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cilofungin: Oligopeptide Research Reference
Cilofungin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Circular Dichroism for Peptides
Discover circular dichroism spectroscopy for analyzing peptide secondary structure and conformational changes. This peptide or oligopeptide is studied for it...
Circular Dichroism: Oligopeptide Research Reference
Circular Dichroism, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Circular RNA: Oligopeptide Research Reference
Comprehensive reference for circular rna, covering molecular structure, pharmacological properties, receptor interactions,
Circulin A/B: Oligopeptide Research Reference
Circulin A/B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CK-MB (Creatine Kinase-MB): Comprehensive Peptide Reference
CK-MB isoenzyme of creatine kinase. Predominantly found in cardiac muscle (~15-25% of total CK in heart). Normal: <5 ng/mL. Rises 4-6h after MI, peaks at 12-...
Cleavage: Oligopeptide Research Reference
Proteolytic processing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
Click Chemistry Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Click Chemistry for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Click Chemistry: Oligopeptide Research Reference
Bioorthogonal reactions: CuAAC, SPAAC. Nobel Prize 2001. Applications: ADCs, PET imaging, PROTACs. This peptide or oligopeptide is studied for its biological...
Clinical Trial Phase 1 Study 1
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 10
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 11
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 12
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 13
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 14
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 15
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 16
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 17
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 18
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 19
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 2
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 20
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 21
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 22
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 23
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 24
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 25
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 26
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 27
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 28
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 29
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 3
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 30
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 31
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 32
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 33
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 34
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 35
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 36
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 37
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 38
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 39
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 4
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 40
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 41
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 42
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 43
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 44
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 45
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 46
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 47
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 48
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 49
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 5
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 50
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 6
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 7
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 8
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 1 Study 9
A Phase 1 clinical trial investigating peptide drug safety, dosing, and pharmacokinetics in a small group of participants.
Clinical Trial Phase 2 Study 1
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 10
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 11
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 12
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 13
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 14
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 15
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 16
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 17
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 18
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 19
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 2
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 20
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 21
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 22
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 23
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 24
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 25
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 26
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 27
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 28
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 29
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 3
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 30
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 31
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 32
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 33
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 34
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 35
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 36
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 37
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 38
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 39
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 4
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 40
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 41
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 42
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 43
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 44
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 45
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 46
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 47
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 48
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 49
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 5
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 50
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 6
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 7
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 8
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trial Phase 2 Study 9
A Phase 2 clinical trial evaluating peptide drug efficacy and side effects in patients with the target condition.. This clinical study provides data on pharm...
Clinical Trials for Peptides: Comprehensive Peptide Refer...
Explore clinical trial design considerations specific to peptide therapeutics including dose-finding and endpoints. Covers molecular mechanisms, biological a...
ClinicalTrials.gov: Oligopeptide Research Reference
NIH registry and results database of publicly and privately funded clinical studies. This peptide or oligopeptide is studied for its biological activity, str...
CLPK: Antimicrobial Peptide Reference
CLPK is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological activ...
CLPY: Antimicrobial Peptide Reference
CLPY is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological activ...
Clt A: Oligopeptide Research Reference
Clt A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CLV3: Oligopeptide Research Reference
CLV3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cmv Peptides: Oligopeptide Research Reference
Peptides associated with Cmv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...
CMV Pp65 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting CMV Pp65 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
CNP 22: Endogenous Peptide Hormone Reference
CNP-22 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...
CNP 22: Oligopeptide Research Reference
CNP 22 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
CNP 53: Endogenous Peptide Hormone Reference
CNP-53 is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis. Covers molecular mechanisms, biological...
CNP Hormone: Endogenous Peptide Hormone Reference
CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CNP Peptide Hormone: Endogenous Peptide Hormone Reference
CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CNP Protein Hormone: Endogenous Peptide Hormone Reference
CNP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CNTF Analog: Oligopeptide Research Reference
CNTF analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
CNTF Hormone: Endogenous Peptide Hormone Reference
CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CNTF Peptide Hormone: Endogenous Peptide Hormone Reference
CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CNTF Protein Hormone: Endogenous Peptide Hormone Reference
CNTF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CNY10: Antimicrobial Peptide Reference
CNY10 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological acti...
Coarse Grained CGenFF for Peptides
A computational method for studying peptides using Coarse Grained CGenFF. This analytical technique provides valuable insights into peptide structure, purity...
Coarse Grained ENM for Peptides
A computational method for studying peptides using Coarse Grained ENM. This analytical technique provides valuable insights into peptide structure, purity, a...
Coarse Grained for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Coarse Grained. This analytical technique provides valuable insights into peptide structure, purity, and c...
Coarse Grained MD for Peptides
A computational method for studying peptides using Coarse Grained MD. This analytical technique provides valuable insights into peptide structure, purity, an...
Coarse Grained SIRAH for Peptides
A computational method for studying peptides using Coarse Grained SIRAH. This analytical technique provides valuable insights into peptide structure, purity,...
Coated Microneedle Peptide: Comprehensive Peptide Reference
Solid microneedles coated with peptide formulations for skin delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Coating Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Coating for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...
Cobratoxin Alpha: Peptide Toxin in Pharmacology Reference
cobratoxin-alpha is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmaco...
Cobratoxin Beta: Peptide Toxin in Pharmacology Reference
cobratoxin-beta is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacol...
Coconut Peptide: Oligopeptide Research Reference
A bioactive peptide derived from coconut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Codorphin: Neuropeptide in Neuroscience Reference
codorphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Coil Assembly System 1: Oligopeptide Research Reference
A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Coil Assembly System 2: Oligopeptide Research Reference
A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Coil Assembly System 3: Oligopeptide Research Reference
A coil-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
ColabFold for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using ColabFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...
Colistimethate: Oligopeptide Research Reference
Colistimethate, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Colistin: Antimicrobial Peptide Reference
Polymyxin lipopeptide antibiotic that disrupts gram-negative bacterial outer membranes, used as last-line therapy for MDR infections.
Colistin: Oligopeptide Research Reference
Cyclic lipopeptide Polymyxin E for extensively drug-resistant gram-negative infections. This peptide or oligopeptide is studied for its biological activity, ...
Collagen Binding Purification: Comprehensive Peptide Refe...
A purification technique for separating and isolating peptides using Collagen Binding. This analytical technique provides valuable insights into peptide stru...
Collagen Elastin Copolymer: Comprehensive Peptide Reference
collagen elastin copolymer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Collagen Peptides (Marine): Comprehensive Peptide Reference
Comprehensive reference for Collagen Peptides (Marine), a peptide compound with applications in research and therapeutics.
Collagen tripeptide: Structure, Function, and Significance
Gly-Pro-Hyp is the most abundant tripeptide repeat in collagen. It is essential for the triple helix stability and is used as a bioactive supplement.
Collagen Triple Helix (Gly-X-Y Repeats)
Comprehensive reference for Collagen Triple Helix (Gly-X-Y Repeats), a peptide compound with applications in research and therapeutics.
Collagen triple helix: Oligopeptide Research Reference
Comprehensive reference for collagen triple helix, covering molecular structure, pharmacological properties, receptor interactions,
Collagenase Inhibitor: Enzyme in Peptide Biology Reference
collagenase inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate s...
Collaxyl: Oligopeptide Research Reference
Palmitoyl tripeptide-1 + tetrapeptide-7. Stimulates collagen. Anti-aging skincare. This peptide or oligopeptide is studied for its biological activity, struc...
colloid for Peptides: Analytical Technique in Peptide Res...
Application of colloid technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...
Colony Stimulating Factor EPO-1-100
Comprehensive reference for colony stimulating factor EPO-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor EPO-1-165
Comprehensive reference for colony stimulating factor EPO-1-165, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor EPO-1-50
Comprehensive reference for colony stimulating factor EPO-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor Flt3L-1-100
Comprehensive reference for colony stimulating factor Flt3L-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor Flt3L-1-150
Comprehensive reference for colony stimulating factor Flt3L-1-150, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor Flt3L-1-220
Comprehensive reference for colony stimulating factor Flt3L-1-220, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor G-CSF-1-100
Comprehensive reference for colony stimulating factor G-CSF-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor G-CSF-1-174
Comprehensive reference for colony stimulating factor G-CSF-1-174, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor G-CSF-1-50
Comprehensive reference for colony stimulating factor G-CSF-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor GM-CSF-1-127
Comprehensive reference for colony stimulating factor GM-CSF-1-127, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor GM-CSF-1-50
Comprehensive reference for colony stimulating factor GM-CSF-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor GM-CSF-1-80
Comprehensive reference for colony stimulating factor GM-CSF-1-80, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor M-CSF-1-100
Comprehensive reference for colony stimulating factor M-CSF-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor M-CSF-1-150
Comprehensive reference for colony stimulating factor M-CSF-1-150, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor M-CSF-1-223
Comprehensive reference for colony stimulating factor M-CSF-1-223, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor SCF-1-100
Comprehensive reference for colony stimulating factor SCF-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor SCF-1-165
Comprehensive reference for colony stimulating factor SCF-1-165, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor SCF-1-50
Comprehensive reference for colony stimulating factor SCF-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor TPO-1-100
Comprehensive reference for colony stimulating factor TPO-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor TPO-1-150
Comprehensive reference for colony stimulating factor TPO-1-150, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor TPO-1-200
Comprehensive reference for colony stimulating factor TPO-1-200, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor TPO-1-332
Comprehensive reference for colony stimulating factor TPO-1-332, covering molecular structure, pharmacological properties, receptor interactions,
Colony Stimulating Factor TPO-1-50
Comprehensive reference for colony stimulating factor TPO-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Colorectal Cancer Peptides: Comprehensive Peptide Reference
Peptides associated with Colorectal Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...
Colorectal Cancer: Oligopeptide Research Reference
Malignant transformation of colonic or rectal epithelium. Molecular pathways: APC/β-catenin (60%), KRAS (40%), MSI (15%). Treatments: surgery, FOLFOX/FOLFIRI...
Companion Diagnostics: Oligopeptide Research Reference
Peptide-based companion diagnostics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Complement C3 Inhibitor: Oligopeptide Research Reference
complement C3 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Complement C3a Antimicrobial: Comprehensive Peptide Refer...
Anaphylatoxin C3a with direct antimicrobial activity against gram-positive and negative bacteria. This antimicrobial peptide demonstrates activity against pa...
Complement C5 Inhibitor: Oligopeptide Research Reference
complement C5 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Complement C5a Antimicrobial: Comprehensive Peptide Refer...
Potent anaphylatoxin with immunomodulatory and direct antimicrobial functions. This antimicrobial peptide demonstrates activity against pathogens and is stud...
Complement Inhibitor C3-inhibitor-1
Comprehensive reference for complement inhibitor C3-inhibitor-1, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-10
Comprehensive reference for complement inhibitor C3-inhibitor-10, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-11
Comprehensive reference for complement inhibitor C3-inhibitor-11, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-12
Comprehensive reference for complement inhibitor C3-inhibitor-12, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-13
Comprehensive reference for complement inhibitor C3-inhibitor-13, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-14
Comprehensive reference for complement inhibitor C3-inhibitor-14, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-15
Comprehensive reference for complement inhibitor C3-inhibitor-15, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-16
Comprehensive reference for complement inhibitor C3-inhibitor-16, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-17
Comprehensive reference for complement inhibitor C3-inhibitor-17, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-18
Comprehensive reference for complement inhibitor C3-inhibitor-18, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-19
Comprehensive reference for complement inhibitor C3-inhibitor-19, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-2
Comprehensive reference for complement inhibitor C3-inhibitor-2, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-20
Comprehensive reference for complement inhibitor C3-inhibitor-20, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-21
Comprehensive reference for complement inhibitor C3-inhibitor-21, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-22
Comprehensive reference for complement inhibitor C3-inhibitor-22, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-23
Comprehensive reference for complement inhibitor C3-inhibitor-23, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-24
Comprehensive reference for complement inhibitor C3-inhibitor-24, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-25
Comprehensive reference for complement inhibitor C3-inhibitor-25, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-26
Comprehensive reference for complement inhibitor C3-inhibitor-26, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-27
Comprehensive reference for complement inhibitor C3-inhibitor-27, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-28
Comprehensive reference for complement inhibitor C3-inhibitor-28, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-29
Comprehensive reference for complement inhibitor C3-inhibitor-29, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-3
Comprehensive reference for complement inhibitor C3-inhibitor-3, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-30
Comprehensive reference for complement inhibitor C3-inhibitor-30, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-31
Comprehensive reference for complement inhibitor C3-inhibitor-31, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-32
Comprehensive reference for complement inhibitor C3-inhibitor-32, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-33
Comprehensive reference for complement inhibitor C3-inhibitor-33, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-34
Comprehensive reference for complement inhibitor C3-inhibitor-34, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-35
Comprehensive reference for complement inhibitor C3-inhibitor-35, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-36
Comprehensive reference for complement inhibitor C3-inhibitor-36, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-37
Comprehensive reference for complement inhibitor C3-inhibitor-37, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-38
Comprehensive reference for complement inhibitor C3-inhibitor-38, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-39
Comprehensive reference for complement inhibitor C3-inhibitor-39, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-4
Comprehensive reference for complement inhibitor C3-inhibitor-4, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-40
Comprehensive reference for complement inhibitor C3-inhibitor-40, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-5
Comprehensive reference for complement inhibitor C3-inhibitor-5, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-6
Comprehensive reference for complement inhibitor C3-inhibitor-6, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-7
Comprehensive reference for complement inhibitor C3-inhibitor-7, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-8
Comprehensive reference for complement inhibitor C3-inhibitor-8, covering molecular structure, pharmacological properties, receptor interactions,
Complement Inhibitor C3-inhibitor-9
Comprehensive reference for complement inhibitor C3-inhibitor-9, covering molecular structure, pharmacological properties, receptor interactions,
complete-response Resource: Comprehensive Peptide Reference
The complete-response database or resource for peptide research, providing data on structure, function, and interactions.
composite-endpoint Resource: Comprehensive Peptide Reference
The composite-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
Computational Design: Oligopeptide Research Reference
AI and computational approaches to peptide design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Computational Technologies: Comprehensive Peptide Reference
In silico methods for peptide design and prediction. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...
Computational Technology Comparison
Comparison of computational tools for peptide design and analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Con-Insulin G1: Peptide Toxin in Pharmacology Reference
Evolutionary modified insulin from Conus geographus with novel receptor selectivity. This peptide toxin is derived from venom and studied for its pharmacolog...
Conantokin G: Peptide Toxin in Pharmacology Reference
NMDA receptor antagonist from Conus geographus with anticonvulsant properties. This peptide toxin is derived from venom and studied for its pharmacological a...
Conantokin T: Peptide Toxin in Pharmacology Reference
NMDA receptor antagonist from Conus tulipa with selective NR2B subunit binding. This peptide toxin is derived from venom and studied for its pharmacological ...
Concentrated Insulin U500: Comprehensive Peptide Reference
Five-fold concentrated regular insulin for insulin-resistant patients requiring high doses. This peptide or oligopeptide is studied for its biological activi...
Cone Snail Drug Discovery: Comprehensive Peptide Reference
Cone snail venom as source of novel therapeutics including ziconotide. This peptide toxin is derived from venom and studied for its pharmacological activity,...
Cone Snail Venoms: Peptide Toxin in Pharmacology Reference
Cav, Nav, nAChR, K+, NET. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applicati...
Cone snail: Peptide Toxin in Pharmacology Reference
~0.01 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...
Cone Venom Analgesic Peptides: Comprehensive Peptide Refe...
Conotoxins with potent analgesic activity for chronic pain treatment. This peptide toxin is derived from venom and studied for its pharmacological activity, ...
Cone Venom Pain Targets: Peptide Toxin in Pharmacology Re...
Molecular targets of conotoxins in pain pathways. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action,...
Confocal Microscopy for Peptides
Learn confocal fluorescence microscopy techniques for visualizing peptide localization in cells and tissues. This peptide or oligopeptide is studied for its ...
Coninsulin S: Peptide Toxin in Pharmacology Reference
Insulin-like peptide from Conus striatus venom causing hypoglycemic shock in prey. This peptide toxin is derived from venom and studied for its pharmacologic...
Conopressin G: Peptide Toxin in Pharmacology Reference
conopressin-G is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for it...
Conopressin S: Peptide Toxin in Pharmacology Reference
conopressin-S is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for it...
Conorfamide: Oligopeptide Research Reference
Conorfamide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Conotoxin (Generic): Peptide Toxin in Pharmacology Reference
Conotoxin (Generic), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Conotoxin Analgesic Pipeline: Comprehensive Peptide Refer...
Clinical pipeline of next-generation conotoxin analgesics. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...
Conotoxin Folding Protocols: Comprehensive Peptide Reference
Oxidative folding strategies for conotoxin disulfide bond formation. This peptide toxin is derived from venom and studied for its pharmacological activity, m...
Conotoxin gviiia: Structure, Function, and Significance
Omega-conotoxin GVIIIA is a potent N-type calcium channel blocker from cone snail venom, used as a research tool for studying pain pathways.
Conotoxin mriia: Structure, Function, and Significance
Ziconotide (Prialt) is derived from omega-conotoxin MVIIA. It is an FDA-approved non-opioid analgesic for severe chronic pain.
Conotoxin MVIIA: Oligopeptide Research Reference
Omega-conotoxin from Conus magus that blocks N-type calcium channels, used as an intrathecal analgesic for severe chronic pain.
Conotoxin research, calcium channel pharmacology
Conotoxin research, calcium channel pharmacology is a bioactive compound with applications in peptide research and therapeutics.
contact-map Resource: Oligopeptide Research Reference
The contact-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Container Closure for Peptides
Learn container closure system requirements for peptide drug products including extractables and leachables testing. Covers molecular mechanisms, biological ...
Contignacin: Peptide Toxin in Pharmacology Reference
contignacin is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for its ...
Continuous Manufacturing: Oligopeptide Research Reference
Continuous production processes for peptides. More efficient than batch processing. This peptide or oligopeptide is studied for its biological activity, stru...
Continuous Subcutaneous Insulin Infusion
Technology and clinical principles of insulin pump therapy providing continuous basal rates and programmable bolus dosing.
Contulakin-G: Oligopeptide Research Reference
Contulakin-G, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Copd Peptides: Oligopeptide Research Reference
Peptides associated with Copd including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...
Corazonin: Oligopeptide Research Reference
Corazonin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cordycepin: Oligopeptide Research Reference
Cordycepin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Corn Peptide: Oligopeptide Research Reference
A bioactive peptide derived from corn with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Corn Zein Peptide: Oligopeptide Research Reference
corn zein peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Corticotropin-Releasing Hormone
A 41-amino acid hypothalamic neuropeptide that initiates the stress response by stimulating ACTH release from the anterior pituitary, activating the HPA axis.
Cortisol Hormone: Endogenous Peptide Hormone Reference
Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Cortisol Peptide Hormone: Endogenous Peptide Hormone Refe...
Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Cortisol Protein Hormone: Endogenous Peptide Hormone Refe...
Cortisol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Cortistatin: Oligopeptide Research Reference
cortistatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Cosmetic Peptide Market: Oligopeptide Research Reference
Market analysis for cosmetic peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Cosmetic Synthetic: Oligopeptide Research Reference
Peptides for topical applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Cosmetic: Oligopeptide Research Reference
Cosmetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity,...
Coursera Peptide Chemistry: Comprehensive Peptide Reference
Online course on peptide chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
Covid 19 Peptides: Oligopeptide Research Reference
Peptides associated with Covid 19 including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
COVID-19: Oligopeptide Research Reference
SARS-CoV-2 respiratory illness. Treatments: antivirals, monoclonal antibodies, corticosteroids. This peptide or oligopeptide is studied for its biological ac...
CPF: Antimicrobial Peptide Reference
CPF, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CpTx1: Peptide Toxin in Pharmacology Reference
CpTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...
Crabrolin (Vespa): Oligopeptide Research Reference
Crabrolin (Vespa), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Crabrolin: Peptide Toxin in Pharmacology Reference
Crabrolin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cranberry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cranberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
CRH (Corticotropin-releasing hormone)
Comprehensive reference for CRH (Corticotropin-releasing hormone), a peptide compound with applications in research and therapeutics.
CRH Hormone: Endogenous Peptide Hormone Reference
CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CRH Peptide Hormone: Endogenous Peptide Hormone Reference
CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
CRH Protein Hormone: Endogenous Peptide Hormone Reference
CRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
Crimean Congo N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Crimean Congo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...
Crocodilian Antimicrobial Serum Proteins
Comprehensive reference for Crocodilian Antimicrobial Serum Proteins, a peptide compound with applications in research and therapeutics.
Crocodilian Cathelicidin: Oligopeptide Research Reference
Comprehensive reference for Crocodilian Cathelicidin, a peptide compound with applications in research and therapeutics.
Crocodilian Defensin: Oligopeptide Research Reference
Crocodilian Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Crocodilian Peptides: Oligopeptide Research Reference
Antimicrobial, Anti-infective. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Crocodilian Serum Proteins: Comprehensive Peptide Reference
Comprehensive reference for Crocodilian Serum Proteins, a peptide compound with applications in research and therapeutics.
Crocodilin: Oligopeptide Research Reference
Crocodilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Crohns Peptides: Oligopeptide Research Reference
Peptides associated with Crohns including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Crop Milk Peptides: Oligopeptide Research Reference
Crop Milk Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Crop Protection: Oligopeptide Research Reference
Use of antimicrobial peptides as biopesticides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Cross Attention for Peptides: Comprehensive Peptide Refer...
A computational method for studying peptides using Cross Attention. This analytical technique provides valuable insights into peptide structure, purity, and ...
Cross-Cutting Themes: Oligopeptide Research Reference
Common themes across peptide-related diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
Cross-Linking MS for Peptides: Comprehensive Peptide Refe...
Understand chemical cross-linking mass spectrometry for mapping peptide-protein interaction interfaces. This peptide or oligopeptide is studied for its biolo...
Cross-Reactive Antibodies: Comprehensive Peptide Reference
Antibodies that cross-react between therapeutic peptides and endogenous proteins. This peptide or oligopeptide is studied for its biological activity, struct...
Crotamine: Peptide Toxin in Pharmacology Reference
Crotamine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CRP (C-Reactive Protein): Oligopeptide Research Reference
Comprehensive reference for CRP (C-Reactive Protein), a peptide compound with applications in research and therapeutics.
Cryo EM SPA Analysis: Analytical Technique in Peptide Res...
An analytical technique for characterizing peptides using Cryo EM SPA. This analytical technique provides valuable insights into peptide structure, purity, a...
Cryo ET Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using Cryo ET. This analytical technique provides valuable insights into peptide structure, purity, and c...
Cryo-Electron Microscopy: Oligopeptide Research Reference
Cryo-EM for determining peptide and protein structures at near-atomic resolution. This peptide or oligopeptide is studied for its biological activity, struct...
cryo-EM for Peptides: Analytical Technique in Peptide Res...
Application of cryo-EM technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...
Cryo-EM for Peptides: Analytical Technique in Peptide Res...
Learn how cryo-electron microscopy enables near-atomic resolution imaging of peptide assemblies and complexes. This peptide or oligopeptide is studied for it...
Cryptdin 1: Antimicrobial Peptide Reference
cryptdin-1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...
Cryptdin 2: Antimicrobial Peptide Reference
cryptdin-2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...
Cryptdin 3: Antimicrobial Peptide Reference
cryptdin-3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...
Cryptdin 4: Antimicrobial Peptide Reference
cryptdin-4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological...
Crystalline Insulin Formulations
Use of zinc-insulin crystallization to create depot formulations providing extended insulin release. This peptide or oligopeptide is studied for its biologic...
Crystalline Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using Crystalline for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
Crystallization: Oligopeptide Research Reference
Crystallization, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
crystallography for Peptides: Comprehensive Peptide Refer...
Application of crystallography technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...
Css II (CssIV): Peptide Toxin in Pharmacology Reference
Css II (CssIV), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Css II: Peptide Toxin in Pharmacology Reference
Css II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CSTX-1: Peptide Toxin in Pharmacology Reference
CSTX-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
CT 1 Hormone: Endogenous Peptide Hormone Reference
CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CT 1 Peptide Hormone: Endogenous Peptide Hormone Reference
CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CT 1 Protein Hormone: Endogenous Peptide Hormone Reference
CT 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
CTLA 4 Blocker: Oligopeptide Research Reference
CTLA 4 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Cucumber Peptide: Oligopeptide Research Reference
A bioactive peptide derived from cucumber with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Curculin: Oligopeptide Research Reference
curculin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Curcumin Peptide: Oligopeptide Research Reference
curcumin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Cutoff Value Interpretation: Comprehensive Peptide Reference
Comprehensive reference for Cutoff Value Interpretation, a peptide compound with applications in research and therapeutics.
Cyanogen Bromide Purification: Comprehensive Peptide Refe...
A purification technique for separating and isolating peptides using Cyanogen Bromide. This analytical technique provides valuable insights into peptide stru...
Cyclic Peptide-Peptoid Hybrids
Chimeric molecules combining cyclic peptide and peptoid elements for enhanced proteolytic stability and cell penetration.
Cyclic peptide: Oligopeptide Research Reference
Comprehensive reference for cyclic peptide, covering molecular structure, pharmacological properties, receptor interactions,
Cyclic Peptides in Drug Discovery
Structural and pharmacological principles of cyclic peptide drug design including head-to-tail cyclization, stapled peptides, and strategies for enhanced cel...
Cyclic Peptides: Oligopeptide Research Reference
Cyclized peptides for enhanced stability. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Cyclic System 1: Oligopeptide Research Reference
A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
Cyclic System 2: Oligopeptide Research Reference
A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
Cyclic System 3: Oligopeptide Research Reference
A cyclic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
Cyclization System 1: Oligopeptide Research Reference
A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Cyclization System 2: Oligopeptide Research Reference
A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Cyclization System 3: Oligopeptide Research Reference
A cyclization-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Cyclization: Post-Translational Modification Reference
5–20x. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therapeut...
Cyclodextrin Peptide Complex: Comprehensive Peptide Refer...
Cyclodextrin inclusion complexes improving peptide stability and solubility. This peptide or oligopeptide is studied for its biological activity, structure-a...
Cyclophilin discovery, calcineurin pathway
Cyclophilin discovery, calcineurin pathway is a bioactive compound with applications in peptide research and therapeutics.
Cyclopsychotride A: Oligopeptide Research Reference
cyclopsychotride-A is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.
Cyclosporin A: Oligopeptide Research Reference
Cyclosporin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cyclosporine: Oligopeptide Research Reference
Cyclic undecapeptide calcineurin inhibitor for immunosuppression in transplantation. This peptide or oligopeptide is studied for its biological activity, str...
Cyclosporine: Oligopeptide Research Reference
cyclosporine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Cyclotides: Oligopeptide Research Reference
Cyclotides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cycloviolacin O2: Oligopeptide Research Reference
Cycloviolacin O2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cystatin C: Oligopeptide Research Reference
cystatin C in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Cysteine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Cysteine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...
Cysteine Modification: Post-Translational Modification Re...
Post-translational modifications of Cysteine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...
Cysteine Peptide: Oligopeptide Research Reference
Cysteine (C) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...
Cysteine protease degrades ECM and immunoglobulins
Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
Cystic Fibrosis Peptides: Oligopeptide Research Reference
Peptides associated with Cystic Fibrosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...
CyTOF Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using CyTOF. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Cytokine Conjugates: Oligopeptide Research Reference
Cytokine Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Cytoskeleton dynamics: Oligopeptide Research Reference
Comprehensive reference for cytoskeleton dynamics, covering molecular structure, pharmacological properties, receptor interactions,
Cytotoxic / Microtubule Inhibitor
Cytotoxic / Microtubule Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Cytotoxic / Topoisomerase Inhibitor
Cytotoxic / Topoisomerase Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
D-Amino Acid Substitution: Comprehensive Peptide Reference
Replacement of L-amino acids with D-enantiomers. Increases proteolytic resistance. This peptide or oligopeptide is studied for its biological activity, struc...
D-dimer: Oligopeptide Research Reference
Fibrin degradation product formed when plasmin cleaves cross-linked fibrin. Marker of fibrinolysis. Normal: <500 ng/mL (age-adjusted). Elevated in DVT, PE, D...
Daclizumab: Oligopeptide Research Reference
Humanized anti-CD25 antibody for transplant rejection prevention and multiple sclerosis (withdrawn due to safety concerns).
Dactinomycin (Actinomycin D): Comprehensive Peptide Refer...
Polyketide-peptide antitumor antibiotic that intercalates DNA and inhibits transcription, used for childhood cancers. Covers molecular mechanisms, biological...
Dactinomycin: Oligopeptide Research Reference
Chromopeptide antibiotic that intercalates into DNA and inhibits RNA polymerase, used as a chemotherapeutic agent for pediatric and testicular cancers.
DADLE: Neuropeptide in Neuroscience Reference
Synthetic delta-opioid selective enkephalin analog with neuroprotective effects. This neuropeptide is involved in neurological signaling and is studied for i...
Dalbavancin: Antimicrobial Peptide Reference
Lipoglycopeptide antibiotic with ultra-long half-life enabling single-dose treatment of acute bacterial skin infections.
DALI Resource: Oligopeptide Research Reference
The DALI database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
Dalteparin: Oligopeptide Research Reference
dalteparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Danuglipron: Oligopeptide Research Reference
Danuglipron, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Daptomycin: Antimicrobial Peptide Reference
Lipopeptide antibiotic from Streptomyces roseosporus that inserts into gram-positive bacterial membranes causing rapid depolarization.
Daptomycin: Antimicrobial Peptide Reference
Cyclic lipopeptide antibiotic that inserts into gram-positive bacterial membranes, causing rapid depolarization and cell death.
Daptomycin: Oligopeptide Research Reference
Cyclic lipopeptide antibiotic disrupting bacterial membrane potential for serious infections. This peptide or oligopeptide is studied for its biological acti...
Darbepoetin Alfa: Oligopeptide Research Reference
Long-acting erythropoiesis-stimulating glycoprotein with additional sialic acid residues for extended half-life in anemia treatment.
Datopotamab Deruxtecan: Oligopeptide Research Reference
Datopotamab Deruxtecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
DBCO Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using DBCO. This analytical technique provides valuable insights into peptide structure, purit...
DCGSCWAFSAIGN: Oligopeptide Research Reference
Trypanosoma cruzi. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...
De Novo Peptide Design with AI
Using artificial intelligence to design novel peptide sequences from scratch. This peptide or oligopeptide is studied for its biological activity, structure-...
Deacetylase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Deacetylase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Deep Learning: Oligopeptide Research Reference
High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Deep Vein Thrombosis: Oligopeptide Research Reference
Deep Vein Thrombosis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Defensin A (Phormia): Oligopeptide Research Reference
Defensin A (Phormia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Defensin B (Phormia): Oligopeptide Research Reference
Defensin B (Phormia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Defensin Gene Regulation: Antimicrobial Peptide Reference
Transcriptional regulation by NF-kB, TLR signaling, and microbial products. This antimicrobial peptide demonstrates activity against pathogens and is studied...
Defensin human alpha: Structure, Function, and Significance
Human alpha-defensins (HNP1-4) are 29-30 residue antimicrobial peptides stored in neutrophil azurophilic granules. They form pores in microbial membranes.
Defensin in Atopic Dermatitis: Comprehensive Peptide Refe...
Altered AMP expression in atopic dermatitis contributing to recurrent skin infections. This antimicrobial peptide demonstrates activity against pathogens and...
Defensin in Chronic Wounds: Comprehensive Peptide Reference
Altered defensin expression in chronic wounds and potential AMP supplementation therapy. This antimicrobial peptide demonstrates activity against pathogens a...
Defensin in Cystic Fibrosis: Comprehensive Peptide Reference
Defective AMP function in CF airways contributing to chronic bacterial infections. This antimicrobial peptide demonstrates activity against pathogens and is ...
Defensin in IBD: Antimicrobial Peptide Reference
Altered Paneth cell defensin expression in Crohn disease affecting intestinal barrier. This antimicrobial peptide demonstrates activity against pathogens and...
Defensin Medical Device Coatings
Surface coatings with defensin peptides for infection prevention on medical devices. This antimicrobial peptide demonstrates activity against pathogens and i...
Defensin Microbiome Interaction
Role of defensins in shaping commensal microbiome and preventing pathogen colonization. This antimicrobial peptide demonstrates activity against pathogens an...
Defensin Rs1: Antimicrobial Peptide Reference
defensin-rs1 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...
Defensin Rs2: Antimicrobial Peptide Reference
defensin-rs2 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...
Defensin Rs3: Antimicrobial Peptide Reference
defensin-rs3 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...
Defensin Rs4: Antimicrobial Peptide Reference
defensin-rs4 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biologic...
Defensin Structural Motif: Comprehensive Peptide Reference
Six-cysteine disulfide framework defining alpha and beta defensin families. This antimicrobial peptide demonstrates activity against pathogens and is studied...
Defensin: Oligopeptide Research Reference
Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Degarelix - CS21 (NCT00106437)
Clinical trial of degarelix for prostate cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Degarelix: Oligopeptide Research Reference
GnRH receptor antagonist for prostate cancer providing immediate androgen deprivation. This peptide or oligopeptide is studied for its biological activity, s...
Degludec Pharmacodynamics: Comprehensive Peptide Reference
Pharmacodynamic profile demonstrating flat glucose-lowering effect with intra-individual variability below 20%. Covers molecular mechanisms, biological activ...
Degludec-Aspart Coformulation: Comprehensive Peptide Refe...
Co-formulation combining ultra-long-acting degludec with rapid-acting aspart for flexible basal-bolus coverage. Covers molecular mechanisms, biological activ...
Delivery Platforms: Oligopeptide Research Reference
Delivery Platforms, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Delivery Technologies: Oligopeptide Research Reference
Systems for peptide administration and transport. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Delivery Technology Comparison
Comparison of different peptide delivery technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...
Delta Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...
delta-conotoxin-GVIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Delta-Conotoxin PVIA: Peptide Toxin in Pharmacology Refer...
Sodium channel modulator from Conus pennaceus affecting action potential kinetics. This peptide toxin is derived from venom and studied for its pharmacologic...
Deltorphin A: Antimicrobial Peptide Reference
Deltorphin A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Deltorphin B: Antimicrobial Peptide Reference
Deltorphin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Deltorphin C: Antimicrobial Peptide Reference
Deltorphin C, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Deltorphin D: Antimicrobial Peptide Reference
Deltorphin D, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Deltorphin I: Neuropeptide in Neuroscience Reference
deltorphin-I is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Deltorphin II: Neuropeptide in Neuroscience Reference
deltorphin-II is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Demeclocycline: Endogenous Peptide Hormone Reference
demeclocycline is an analog or modulator of oxytocin signaling used in obstetric and other clinical applications. Covers molecular mechanisms, biological act...
Dendrimer encapsulation: Oligopeptide Research Reference
Comprehensive reference for dendrimer encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Dendrimer System 1: Oligopeptide Research Reference
A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendrimer System 2: Oligopeptide Research Reference
A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendrimer System 3: Oligopeptide Research Reference
A dendrimer-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendritic peptide: Oligopeptide Research Reference
Comprehensive reference for dendritic peptide, covering molecular structure, pharmacological properties, receptor interactions,
Dendritic System 1: Oligopeptide Research Reference
A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendritic System 2: Oligopeptide Research Reference
A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendritic System 3: Oligopeptide Research Reference
A dendritic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Dendroaspis Natriuretic: Endogenous Peptide Hormone Refer...
Dendroaspis-natriuretic is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.
Dendrotoxin I: Peptide Toxin in Pharmacology Reference
dendrotoxin-I is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...
Dendrotoxin K: Peptide Toxin in Pharmacology Reference
dendrotoxin-K is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...
Dendrotoxin M: Peptide Toxin in Pharmacology Reference
dendrotoxin-M is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacolog...
Dendrotoxin: Oligopeptide Research Reference
Dendrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Dengue E Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Dengue E for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Dengue NS1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Dengue NS1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Dengue Peptides: Oligopeptide Research Reference
Peptides associated with Dengue including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Denosumab: Oligopeptide Research Reference
RANKL inhibitor monoclonal antibody preventing osteoclast formation for bone density improvement. This peptide or oligopeptide is studied for its biological ...
Density Functional for Peptides
A computational method for studying peptides using Density Functional. This analytical technique provides valuable insights into peptide structure, purity, a...
Deoxyribozyme: Oligopeptide Research Reference
Comprehensive reference for deoxyribozyme, covering molecular structure, pharmacological properties, receptor interactions,
Depot injection: Oligopeptide Research Reference
Comprehensive reference for depot injection, covering molecular structure, pharmacological properties, receptor interactions,
Depot System 1: Oligopeptide Research Reference
A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Depot System 2: Oligopeptide Research Reference
A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Depot System 3: Oligopeptide Research Reference
A depot-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Depression and Peptides: Oligopeptide Research Reference
Explore neuropeptide systems in depression including oxytocin, vasopressin, and melanocortin-based therapies. This peptide or oligopeptide is studied for its...
Depression Peptides: Oligopeptide Research Reference
Peptides associated with Depression including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Depression: Oligopeptide Research Reference
Major depressive disorder (MDD) characterized by persistent depressed mood or anhedonia for ≥2 weeks, plus ≥4 additional symptoms (weight change, sleep distu...
Depsipeptide Chemistry: Oligopeptide Research Reference
Chemistry and pharmacology of depsipeptides containing both amide and ester bonds, including natural products and drug candidates.
Dermaseptin B2: Antimicrobial Peptide Reference
Potent frog AMP selective against Candida albicans and cancer cells. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...
Dermaseptin S1: Antimicrobial Peptide Reference
dermaseptin-s1 is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...
Dermaseptin: Antimicrobial Peptide Reference
Amphipathic alpha-helical AMP from frog skin active against protozoa and bacteria. This antimicrobial peptide demonstrates activity against pathogens and is ...
Dermcidin: Antimicrobial Peptide Reference
Sweat gland-derived antimicrobial peptide providing constitutive skin surface defense. This antimicrobial peptide demonstrates activity against pathogens and...
Dermorphin: Antimicrobial Peptide Reference
Dermorphin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
DESI MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using DESI MS. This analytical technique provides valuable insights into peptide structure, purity, and c...
Desirudin: Oligopeptide Research Reference
Recombinant hirudin variant for DVT prophylaxis after hip replacement surgery. This peptide or oligopeptide is studied for its biological activity, structure...
Desirudin: Oligopeptide Research Reference
desirudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Deslorelin: Oligopeptide Research Reference
Ultra-potent GnRH agonist with D-Trp6 modification primarily for veterinary use. This peptide or oligopeptide is studied for its biological activity, structu...
Desmin intermediate filament: Comprehensive Peptide Refer...
Comprehensive reference for desmin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,
Desmopressin: Oligopeptide Research Reference
Vasopressin analog. FDA-approved for DI, nocturnal enuresis, hemophilia. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Desmopressin: Oligopeptide Research Reference
desmopressin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Destruxin: Oligopeptide Research Reference
Destruxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
DHEA Hormone: Endogenous Peptide Hormone Reference
DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
DHEA Peptide Hormone: Endogenous Peptide Hormone Reference
DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
DHEA Protein Hormone: Endogenous Peptide Hormone Reference
DHEA, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
Diabetes and Peptides: Oligopeptide Research Reference
Discover peptide-based therapies for diabetes management including GLP-1 analogs and insulin derivatives. This peptide or oligopeptide is studied for its bio...
Diabetes Peptides: Oligopeptide Research Reference
Peptides associated with Diabetes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Diabetes Treatment: Oligopeptide Research Reference
Peptide therapeutics for diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Diabody System 1: Oligopeptide Research Reference
A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Diabody System 2: Oligopeptide Research Reference
A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Diabody System 3: Oligopeptide Research Reference
A diabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Diabody: Oligopeptide Research Reference
Comprehensive reference for diabody, covering molecular structure, pharmacological properties, receptor interactions,
Diafiltration Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Diafiltration. This analytical technique provides valuable insights into peptide structu...
Diagnostic / PET Imaging: Oligopeptide Research Reference
Diagnostic / PET Imaging is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Diagnostic Synthetic: Oligopeptide Research Reference
Radiolabeled peptide imaging agents. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Diagnostic: Oligopeptide Research Reference
Diagnostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...
Diagnostics Peptides: Biomarker Discovery and Clinical As...
Explore peptide-based diagnostic technologies for disease detection, monitoring, and personalized medicine. This peptide or oligopeptide is studied for its b...
dialysis for Peptides: Analytical Technique in Peptide Re...
Application of dialysis technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biol...
Dialysis Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using Dialysis. This analytical technique provides valuable insights into peptide structure, p...
Diamyd: Oligopeptide Research Reference
Diamyd, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Didinium nasutum: Oligopeptide Research Reference
Discharged from toxicysts upon contact. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Diels Alder Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using Diels Alder for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
Differential Scanning Calorimetry for Peptides
Discover DSC techniques for measuring peptide thermal stability and thermodynamic folding parameters. This peptide or oligopeptide is studied for its biologi...
differential-scanning for Peptides
Application of differential-scanning technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological...
diffraction for Peptides: Analytical Technique in Peptide...
Application of diffraction technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...
Diffusion Model for Peptides: Comprehensive Peptide Refer...
A computational method for studying peptides using Diffusion Model. This analytical technique provides valuable insights into peptide structure, purity, and ...
Digital Health Integration: Comprehensive Peptide Reference
Integration of peptide therapeutics with digital health technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Digital Health Peptides: Wearable Biosensors and Smart Di...
Explore peptide-integrated wearable devices for real-time health monitoring and point-of-care diagnostics. This peptide or oligopeptide is studied for its bi...
dihedral-angle Resource: Oligopeptide Research Reference
The dihedral-angle database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Dimensionality Reduction for Peptides
A computational method for studying peptides using Dimensionality Reduction. This analytical technique provides valuable insights into peptide structure, pur...
Diphtheria Toxin (DT): Peptide Toxin in Pharmacology Refe...
Diphtheria Toxin (DT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Diphtheria Toxin: Peptide Toxin in Pharmacology Reference
Diphtheria Toxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
dipole-moment Resource: Oligopeptide Research Reference
The dipole-moment database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...
Diptericin: Antimicrobial Peptide Reference
Glycine-rich AMP from Drosophila with gram-negative antibacterial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied...
Discodermolide: Oligopeptide Research Reference
Discodermolide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Disease Biomarkers: Oligopeptide Research Reference
Peptide biomarkers for disease diagnosis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Disease Categories Overview: Comprehensive Peptide Reference
Overview of disease categories relevant to peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Disordered System 1: Oligopeptide Research Reference
A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Disordered System 2: Oligopeptide Research Reference
A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Disordered System 3: Oligopeptide Research Reference
A disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
dissociation-constant Resource
The dissociation-constant database or resource for peptide research, providing data on structure, function, and interactions.
distance-map Resource: Oligopeptide Research Reference
The distance-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ...
DistilBERT for Peptides: Analytical Technique in Peptide ...
A computational method for studying peptides using DistilBERT. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Disulfide Bond Formation Synthesis
A peptide synthesis method using Disulfide Bond Formation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...
Disulfide Bonds in Peptides: Comprehensive Peptide Reference
Overview of disulfide bond formation between cysteine residues in peptide folding. This modification affects peptide stability, receptor binding, and biologi...
disulfide-map Resource: Oligopeptide Research Reference
The disulfide-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...
Diuretic Hormone: Oligopeptide Research Reference
Diuretic Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
DLS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using DLS. This analytical technique provides valuable insights into peptide structure, purity, and chara...
DLS for Peptide Size: Analytical Technique in Peptide Res...
Learn dynamic light scattering techniques for measuring peptide particle size, aggregation, and oligomeric state. Covers molecular mechanisms, biological act...
DNA Conjugation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using DNA Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...
DNA methylation: Oligopeptide Research Reference
Comprehensive reference for dna methylation, covering molecular structure, pharmacological properties, receptor interactions,
DNMT Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting DNMT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
Docking for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using Docking. This analytical technique provides valuable insights into peptide structure, purity, and characte...
Docking Studies for Peptides: Comprehensive Peptide Refer...
Learn molecular docking methods for predicting peptide-receptor binding poses and interaction energies. This peptide or oligopeptide is studied for its biolo...
Docking Studies: Oligopeptide Research Reference
Computational methods for predicting peptide-protein binding modes. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Dodecapeptide: Oligopeptide Research Reference
Dodecapeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Dolastatin 10: Oligopeptide Research Reference
Dolastatin 10, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Domoic Acid: Oligopeptide Research Reference
Domoic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Donanemab: Oligopeptide Research Reference
Donanemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Dornase Alfa: Oligopeptide Research Reference
dornase alfa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
dose-limiting-toxicity Resource
The dose-limiting-toxicity database or resource for peptide research, providing data on structure, function, and interactions.
DPDPE: Neuropeptide in Neuroscience Reference
Cyclic delta-opioid peptide agonist with improved metabolic stability. This neuropeptide is involved in neurological signaling and is studied for its roles i...
DPP 4 Inhibitor: Enzyme in Peptide Biology Reference
DPP 4 inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifi...
DPP-4 enzyme biology, incretin hypothesis
DPP-4 enzyme biology, incretin hypothesis is a bioactive compound with applications in peptide research and therapeutics.
DPX-E7: Oligopeptide Research Reference
DPX-E7, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
DRAMP: Oligopeptide Research Reference
Database of Research on Antimicrobial Peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Drosomycin: Antimicrobial Peptide Reference
Antifungal defensin from Drosophila hemolymph providing innate immune defense. This antimicrobial peptide demonstrates activity against pathogens and is stud...
Drug delivery system: Oligopeptide Research Reference
Comprehensive reference for drug delivery system, covering molecular structure, pharmacological properties, receptor interactions,
Drug Interactions: Oligopeptide Research Reference
Enhanced toxicity or reduced efficacy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
DrugBank: Therapeutic Peptide Drug Profile
Comprehensive drug and drug target database combining detailed drug data with drug target information. This peptide or oligopeptide is studied for its biolog...
DSF Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using DSF. This analytical technique provides valuable insights into peptide structure, purity, and chara...
DSGYDGSGYDGSGYD: Oligopeptide Research Reference
Streptomyces nodosus. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...
DSLET: Neuropeptide in Neuroscience Reference
Delta-opioid selective enkephalin analog for pharmacological studies. This neuropeptide is involved in neurological signaling and is studied for its roles in...
DTNB Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using DTNB. This analytical technique provides valuable insights into peptide structure, purit...
DTx1: Peptide Toxin in Pharmacology Reference
DTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...
DTx3: Peptide Toxin in Pharmacology Reference
DTx3 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...
Dual Agonists in Obesity: Oligopeptide Research Reference
A review of GIP/GLP-1 dual receptor agonists for obesity treatment, including retatrutide and survodutide, with analysis of clinical trial outcomes and weigh...
DUAL I Trial: Oligopeptide Research Reference
Phase 3 trial demonstrating superiority of degludec-liraglutide over glargine in HbA1c reduction with less hypoglycemia.
Duck Cathelicidin (ApCATH): Comprehensive Peptide Reference
Comprehensive reference for Duck Cathelicidin (ApCATH), a peptide compound with applications in research and therapeutics.
Duck Cathelicidin: Oligopeptide Research Reference
Duck Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Duck Defensin: Oligopeptide Research Reference
Duck Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Dulaglutide Fc Fusion Technology
Once-weekly GLP-1 receptor agonist using human IgG4 Fc domain fusion for extended half-life through FcRn-mediated recycling.
Dulaglutide: Oligopeptide Research Reference
Long-acting GLP-1 receptor agonist fused to human IgG4 Fc for once-weekly type 2 diabetes treatment. This peptide or oligopeptide is studied for its biologic...
Dulaglutide: Oligopeptide Research Reference
Once-weekly GLP-1 agonist fused to modified Fc domain for extended half-life and DPP-4 resistance. This peptide or oligopeptide is studied for its biological...
duration-of-response Resource: Comprehensive Peptide Refe...
The duration-of-response database or resource for peptide research, providing data on structure, function, and interactions.
Durvalumab: Oligopeptide Research Reference
durvalumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Dynamic Light Scattering: Oligopeptide Research Reference
DLS for measuring peptide size distribution and aggregation state. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
dynamic-light-scattering for Peptides
Application of dynamic-light-scattering technique for peptide characterization, structure determination, or formulation.
Dynorphin A 1-13: Neuropeptide in Neuroscience Reference
Truncated dynorphin A with retained kappa-opioid selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...
Dynorphin A-1-10: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-11: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-11 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-12: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-14: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-15: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-16: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-17: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-8: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A-1-9: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin A-1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin A: Neuropeptide in Neuroscience Reference
A 17-amino acid opioid neuropeptide derived from prodynorphin that preferentially activates kappa-opioid receptors, mediating pain modulation, stress respons...
Dynorphin B-1-13: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin B-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin B-1-14: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin B-1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin B-1-15: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin B-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin B-1-16: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin B-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin B-1-17: Neuropeptide in Neuroscience Reference
Comprehensive reference for dynorphin B-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Dynorphin B: Neuropeptide in Neuroscience Reference
Prodynorphin-derived opioid with kappa-opioid receptor selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Dynorphin Paradoxical Pain: Comprehensive Peptide Reference
Paradoxical pronociceptive effects of dynorphin through non-opioid mechanisms. This neuropeptide is involved in neurological signaling and is studied for its...
Dynorphin Stress Response: Comprehensive Peptide Reference
Role of dynorphin/kappa-opioid system in stress and dysphoria. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
E Coli Esbl Peptide: Oligopeptide Research Reference
A peptide associated with E Coli Esbl for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
E Coli Peptide: Oligopeptide Research Reference
A peptide associated with E Coli for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-act...
E Faecium Peptide: Oligopeptide Research Reference
A peptide associated with E Faecium for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-...
E Faecium Vre Peptide: Oligopeptide Research Reference
A peptide associated with E Faecium Vre for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
E Rhusiopathiae Peptide: Oligopeptide Research Reference
A peptide associated with E Rhusiopathiae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...
Earthworm Antimicrobial / Lysozyme
Earthworm Antimicrobial / Lysozyme is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ac...
Earthworm Antimicrobial Peptide
Earthworm Antimicrobial Peptide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Earthworm Fibrinolytic Enzyme (EFE)
Comprehensive reference for Earthworm Fibrinolytic Enzyme (EFE), a peptide compound with applications in research and therapeutics.
Ebola GP Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Ebola GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Ebola Peptides: Oligopeptide Research Reference
Peptides associated with Ebola including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ...
EBV LMP1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting EBV LMP1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
EBV LMP2 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting EBV LMP2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Ebv Peptides: Oligopeptide Research Reference
Peptides associated with Ebv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...
Ecallantide: Oligopeptide Research Reference
Plasma kallikrein inhibitor for hereditary angioedema preventing bradykinin generation. This peptide or oligopeptide is studied for its biological activity, ...
Echinocandin B: Oligopeptide Research Reference
Echinocandin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Echinococcus Peptides: Oligopeptide Research Reference
Echinococcus Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Eclosion Hormone: Oligopeptide Research Reference
Eclosion Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ecnoglutide: Oligopeptide Research Reference
Ecnoglutide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Eculizumab: Oligopeptide Research Reference
eculizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Eczema Peptides: Oligopeptide Research Reference
Peptides associated with Eczema including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Edman Degradation: Analytical Technique in Peptide Research
Understand the Edman degradation method for sequential N-terminal sequencing of peptides and proteins. This peptide or oligopeptide is studied for its biolog...
edX Protein Engineering: Oligopeptide Research Reference
Online course on protein engineering principles and applications. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
efficacy-endpoint Resource: Comprehensive Peptide Reference
The efficacy-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
Efinopegdutide: Oligopeptide Research Reference
Once-weekly PEGylated GLP-1 agonist for NASH treatment in clinical development. This peptide or oligopeptide is studied for its biological activity, structur...
Efpeglenatide: Oligopeptide Research Reference
efpeglenatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Efpeglenatide: Oligopeptide Research Reference
Long-acting GLP-1 agonist with albumin-binding fatty acid for once-monthly dosing. This peptide or oligopeptide is studied for its biological activity, struc...
Efrapeptin: Oligopeptide Research Reference
Efrapeptin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Efruxifermin: Oligopeptide Research Reference
Efruxifermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
EGCG Peptide: Oligopeptide Research Reference
EGCG peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
EGF Hormone: Endogenous Peptide Hormone Reference
EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
EGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting EGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
EGF Peptide Hormone: Endogenous Peptide Hormone Reference
EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
EGF Protein Hormone: Endogenous Peptide Hormone Reference
EGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
EGFR Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting EGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
EGFR Inhibitor: Oligopeptide Research Reference
EGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Egg Ovotransferrin: Oligopeptide Research Reference
egg ovotransferrin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Egg White Peptides: Oligopeptide Research Reference
Egg White Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Egg Yolk Peptides: Oligopeptide Research Reference
Egg Yolk Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Eggplant Peptide: Oligopeptide Research Reference
A bioactive peptide derived from eggplant with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Eggshell Matrix Peptides: Oligopeptide Research Reference
Comprehensive reference for Eggshell Matrix Peptides, a peptide compound with applications in research and therapeutics.
Eggshell Peptides: Oligopeptide Research Reference
Eggshell Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Eiseniapore: Oligopeptide Research Reference
Eiseniapore, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Elagolix: Oligopeptide Research Reference
Oral GnRH antagonist for endometriosis-associated pain with dose-dependent estrogen suppression. This peptide or oligopeptide is studied for its biological a...
Elastic Network for Peptides: Comprehensive Peptide Refer...
A computational method for studying peptides using Elastic Network. This analytical technique provides valuable insights into peptide structure, purity, and ...
Elastin Binding Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Elastin Binding. This analytical technique provides valuable insights into peptide struc...
Elastin peptide: Structure, Function, and Significance
Elastin-derived peptides contain VPGVG repeats that provide elasticity to connective tissues. They are used in cosmetic and nutraceutical products.
Elastin Peptides (Marine): Comprehensive Peptide Reference
Comprehensive reference for Elastin Peptides (Marine), a peptide compound with applications in research and therapeutics.
Elcatonin: Oligopeptide Research Reference
Synthetic eel calcitonin analogue with reduced immunogenicity for osteoporosis treatment. This peptide or oligopeptide is studied for its biological activity...
ELECTRA for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using ELECTRA. This analytical technique provides valuable insights into peptide structure, purity, and characte...
Electrochemical Synthesis: Comprehensive Peptide Reference
mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Electrochemical Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Electrochemical for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Electrochemiluminescence: Oligopeptide Research Reference
Roche platforms. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...
electron-affinity Resource: Comprehensive Peptide Reference
The electron-affinity database or resource for peptide research, providing data on structure, function, and interactions.
electronegativity Resource: Comprehensive Peptide Reference
The electronegativity database or resource for peptide research, providing data on structure, function, and interactions.
electrophoresis for Peptides: Comprehensive Peptide Refer...
Application of electrophoresis technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...
Electrophoresis: Oligopeptide Research Reference
Electrophoresis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Electrophoretic Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Electrophoretic for producing peptides with specific properties. This analytical technique provides valuable insights into p...
electrospinning for Peptides: Comprehensive Peptide Refer...
Application of electrospinning technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...
Electrospray Ionization MS for Peptides
Learn ESI-MS methods for peptide sequencing, quantification, and characterization of post-translational modifications. Covers molecular mechanisms, biologica...
Electrospun Fiber Peptide Delivery
Explore electrospun nanofiber scaffolds for localized peptide delivery in wound healing and tissue repair. This peptide or oligopeptide is studied for its bi...
electrostatic-potential Resource
The electrostatic-potential database or resource for peptide research, providing data on structure, function, and interactions.
Eli Lilly: Oligopeptide Research Reference
Tirzepatide, Dulaglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
ELISA Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using ELISA. This analytical technique provides valuable insights into peptide structure, purity, and cha...
ELISA for Peptide Detection: Comprehensive Peptide Reference
Learn enzyme-linked immunosorbent assay methods for sensitive quantitative peptide detection in biological samples. Covers molecular mechanisms, biological a...
Elisidepsin: Oligopeptide Research Reference
Elisidepsin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ELISPOT Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using ELISPOT. This analytical technique provides valuable insights into peptide structure, purity, and c...
Ellman Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using Ellman. This analytical technique provides valuable insights into peptide structure, pur...
Ellmans Reagent Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Ellmans Reagent. This analytical technique provides valuable insights into peptide struc...
Elosulfase Alfa: Oligopeptide Research Reference
Elosulfase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
EMA EPAR: Oligopeptide Research Reference
European Medicines Agency European Public Assessment Reports for drugs. This peptide or oligopeptide is studied for its biological activity, structure-activi...
EMA Peptide Drug Approval: Comprehensive Peptide Reference
Understand the European Medicines Agency process for peptide drug authorization including centralized procedure steps. Covers molecular mechanisms, biologica...
Embedding for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using Embedding. This analytical technique provides valuable insights into peptide structure, purity, and charac...
EMDB: Oligopeptide Research Reference
Electron Microscopy Data Bank for cryo-EM structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...
Emerging Therapeutic Strategies
Comprehensive reference for Emerging Therapeutic Strategies, a peptide compound with applications in research and therapeutics.
Emulsified Peptide Delivery: Comprehensive Peptide Reference
Oil-in-water emulsions for oral peptide delivery with lipid-based absorption enhancement. This peptide or oligopeptide is studied for its biological activity...
emulsion for Peptides: Analytical Technique in Peptide Re...
Application of emulsion technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biol...
Enalaprilat: Oligopeptide Research Reference
Active metabolite of enalapril and intravenous ACE inhibitor for hypertensive emergencies and heart failure. This peptide or oligopeptide is studied for its ...
Enalaprilat: Oligopeptide Research Reference
Enalaprilat, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Endocannabinoid Peptides: Neuropeptide in Neuroscience Re...
Lipid-peptide mediators of retrograde synaptic signaling in CNS. This neuropeptide is involved in neurological signaling and is studied for its roles in brai...
Endocrine / Somatostatin Analog
Endocrine / Somatostatin Analog is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Endocrine / Vasopressin: Oligopeptide Research Reference
Endocrine / Vasopressin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...
Endocrine: Endogenous Peptide Hormone Reference
Clinical trials for endocrine-related diseases. This endogenous peptide hormone plays important roles in physiological regulation and is studied for therapeu...
Endogenous opioid peptide: Comprehensive Peptide Reference
Endogenous opioid peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...
Endogenous Opioid System: Neuropeptide in Neuroscience Re...
Overview of opioid peptides, receptors, and roles in pain and reward. This neuropeptide is involved in neurological signaling and is studied for its roles in...
Endokinin A: Neuropeptide in Neuroscience Reference
endokinin-A is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...
Endokinin B: Neuropeptide in Neuroscience Reference
endokinin-B is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...
Endometrial Cancer Peptides: Comprehensive Peptide Reference
Peptides associated with Endometrial Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...
Endomorphin-1: Neuropeptide in Neuroscience Reference
Highly selective mu-opioid endogenous peptide from hypothalamus. This neuropeptide is involved in neurological signaling and is studied for its roles in brai...
Endomorphin-2: Neuropeptide in Neuroscience Reference
Mu-opioid selective peptide with preferential spinal cord distribution. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Endorphin alpha-1-16: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-17: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-18: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-19: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-20: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-21: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-22: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-23: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin alpha-1-24: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin alpha-1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin Alpha: Neuropeptide in Neuroscience Reference
endorphin-alpha is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Endorphin beta-1-16: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-17: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-18: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-19: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-20: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-21: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-22: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-23: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-24: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-25: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin beta-1-26: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin beta-1-26 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin Beta: Neuropeptide in Neuroscience Reference
endorphin-beta is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Endorphin gamma-1-16: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin gamma-1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin gamma-1-17: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin gamma-1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin gamma-1-18: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin gamma-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin gamma-1-19: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin gamma-1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin gamma-1-20: Neuropeptide in Neuroscience Reference
Comprehensive reference for endorphin gamma-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Endorphin Gamma: Neuropeptide in Neuroscience Reference
endorphin-gamma is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Endorphin Pain Modulation: Comprehensive Peptide Reference
Endorphin-mediated descending pain inhibition from brainstem to spinal cord. This neuropeptide is involved in neurological signaling and is studied for its r...
Endothelin 1 Hormone: Endogenous Peptide Hormone Reference
Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 1 Peptide Hormone: Comprehensive Peptide Refer...
Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 1 Protein Hormone: Comprehensive Peptide Refer...
Endothelin 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 1: Oligopeptide Research Reference
endothelin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Endothelin 1: Oligopeptide Research Reference
Potent vasoconstrictor 21-amino acid peptide from endothelial cells that regulates vascular tone and blood pressure. Covers molecular mechanisms, biological ...
Endothelin 2 Hormone: Endogenous Peptide Hormone Reference
Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 2 Peptide Hormone: Comprehensive Peptide Refer...
Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 2 Protein Hormone: Comprehensive Peptide Refer...
Endothelin 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 3 Hormone: Endogenous Peptide Hormone Reference
Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 3 Peptide Hormone: Comprehensive Peptide Refer...
Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 3 Protein Hormone: Comprehensive Peptide Refer...
Endothelin 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Endothelin 3: Oligopeptide Research Reference
endothelin 3 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Endothelin Family Peptides: Comprehensive Peptide Reference
Guide to endothelin peptides ET-1, ET-2, ET-3 in vasoconstriction and cardiovascular regulation. This peptide or oligopeptide is studied for its biological a...
Enfortumab Vedotin: Oligopeptide Research Reference
Antibody-drug conjugate targeting Nectin-4 with monomethyl auristatin E payload for urothelial cancer. This peptide or oligopeptide is studied for its biolog...
Enfuvirtide: Oligopeptide Research Reference
enfuvirtide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Enfuvirtide: Oligopeptide Research Reference
Synthetic 36-amino acid peptide HIV fusion inhibitor that blocks gp41-mediated viral entry into CD4 cells. This peptide or oligopeptide is studied for its bi...
Enfuvirtide: Oligopeptide Research Reference
Fusion inhibitor peptide blocking HIV gp41-mediated membrane fusion for treatment-experienced patients. This peptide or oligopeptide is studied for its biolo...
Enhanced Sampling for Peptides
A computational method for studying peptides using Enhanced Sampling. This analytical technique provides valuable insights into peptide structure, purity, an...
Enkephalin leu-1-2: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-3: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-4: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-6: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-7: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-1-8: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-2-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-2-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-3-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-3-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin leu-4-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin leu-4-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-2: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-3: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-4: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-6: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-7: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-1-8: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-2-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-2-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-3-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-3-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin met-4-5: Neuropeptide in Neuroscience Reference
Comprehensive reference for enkephalin met-4-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Enkephalin Pain Modulation: Comprehensive Peptide Reference
Enkephalin-mediated pain modulation in spinal cord and brainstem. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...
Enkephalin Spinal Analgesia: Comprehensive Peptide Reference
Segmental enkephalin-mediated pain inhibition in dorsal horn. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...
Enniatin: Oligopeptide Research Reference
Enniatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Enoxaparin: Oligopeptide Research Reference
enoxaparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Ensembl (Genomic): Oligopeptide Research Reference
Genomic database for genome annotation and comparative genomics. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Ensembl: Oligopeptide Research Reference
Genome browser and annotation database. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Enteric Coated Peptide Capsules
Enteric coatings protecting peptides from gastric acid and enzymes. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Enteric Coating for Peptides: Comprehensive Peptide Refer...
Explore enteric polymer coatings that protect oral peptides from gastric degradation in the stomach. This peptide or oligopeptide is studied for its biologic...
Enteric Defensin HD5: Antimicrobial Peptide Reference
Paneth cell defensin critical for intestinal stem cell niche and microbiome composition. This antimicrobial peptide demonstrates activity against pathogens a...
Enterokinase Cleavage Purification
A purification technique for separating and isolating peptides using Enterokinase Cleavage. This analytical technique provides valuable insights into peptide...
Environmental Remediation: Comprehensive Peptide Reference
Comprehensive reference for Environmental Remediation, a peptide compound with applications in research and therapeutics.
Enzymatic Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Enzymatic for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Enzymatic Synthesis: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Enzyme Cleavable Purification: Comprehensive Peptide Refe...
A purification technique for separating and isolating peptides using Enzyme Cleavable. This analytical technique provides valuable insights into peptide stru...
Enzyme Conjugation Synthesis: Comprehensive Peptide Refer...
A peptide synthesis method using Enzyme Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights int...
Enzyme-linked immunosorbent assay
Research, clinical. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
Ephrin A1 Agonist: Oligopeptide Research Reference
ephrin A1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Epibatidine: Peptide Toxin in Pharmacology Reference
Epibatidine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Epidermal Growth Factor 1-20: Comprehensive Peptide Refer...
Comprehensive reference for epidermal growth factor 1-20, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 1-30: Comprehensive Peptide Refer...
Comprehensive reference for epidermal growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 1-40: Comprehensive Peptide Refer...
Comprehensive reference for epidermal growth factor 1-40, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 1-48: Comprehensive Peptide Refer...
Comprehensive reference for epidermal growth factor 1-48, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 1-53: Comprehensive Peptide Refer...
Comprehensive reference for epidermal growth factor 1-53, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 10-53: Comprehensive Peptide Refe...
Comprehensive reference for epidermal growth factor 10-53, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 20-53: Comprehensive Peptide Refe...
Comprehensive reference for epidermal growth factor 20-53, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 30-53: Comprehensive Peptide Refe...
Comprehensive reference for epidermal growth factor 30-53, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor 40-53: Comprehensive Peptide Refe...
Comprehensive reference for epidermal growth factor 40-53, covering molecular structure, pharmacological properties, receptor interactions,
Epidermal Growth Factor Family
Learn about EGF, TGF-alpha, and amphiregulin in epithelial growth and cancer biology. This peptide or oligopeptide is studied for its biological activity, st...
Epidermin: Antimicrobial Peptide Reference
epidermin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biologi...
Epigenetics: Oligopeptide Research Reference
Comprehensive reference for epigenetics, covering molecular structure, pharmacological properties, receptor interactions,
Epilepsy Peptides: Oligopeptide Research Reference
Peptides associated with Epilepsy including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Epilepsy: Oligopeptide Research Reference
Neuronal hyperexcitability causing recurrent unprovoked seizures. Classification: focal (partial) or generalized. Etiology: idiopathic (genetic, 60%), sympto...
Epinecidin-1: Oligopeptide Research Reference
Epinecidin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
EPO Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting EPO Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Epoetin Alfa: Oligopeptide Research Reference
epoetin alfa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Epoetin Alfa: Oligopeptide Research Reference
Recombinant human erythropoietin for anemia treatment in chronic kidney disease and chemotherapy. This peptide or oligopeptide is studied for its biological ...
EPR for Peptides: Analytical Technique in Peptide Research
Application of EPR technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...
Epsilon Bungarotoxin: Peptide Toxin in Pharmacology Refer...
epsilon-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its phar...
Eptifibatide: Oligopeptide Research Reference
eptifibatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Eptifibatide: Oligopeptide Research Reference
Cyclic heptapeptide GPIIb/IIIa inhibitor derived from rattlesnake venom, used for acute coronary syndromes and PCI. Covers molecular mechanisms, biological a...
Eptifibatide: Oligopeptide Research Reference
Cyclic heptapeptide GP IIb/IIIa inhibitor containing KGD for acute coronary syndromes. This peptide or oligopeptide is studied for its biological activity, s...
Eptinezumab: Oligopeptide Research Reference
Anti-CGRP monoclonal antibody for migraine prevention administered as quarterly IV infusion. This peptide or oligopeptide is studied for its biological activ...
EPV-01: Oligopeptide Research Reference
EPV-01, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Erabutoxin: Structure, Function, and Significance
Erabutoxins are three-finger toxins from sea snake venom that block neuromuscular junction acetylcholine receptors. Covers molecular mechanisms, biological a...
Eravacycline: Oligopeptide Research Reference
Eravacycline, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Erenumab: Oligopeptide Research Reference
Monoclonal antibody against CGRP receptor for migraine prevention with monthly dosing. This peptide or oligopeptide is studied for its biological activity, s...
Ergocristine: Oligopeptide Research Reference
Ergocristine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ergotamine: Oligopeptide Research Reference
Ergotamine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Eribulin Mesylate: Oligopeptide Research Reference
Synthetic halichondrin B analog microtubule dynamics inhibitor for metastatic breast cancer and liposarcoma. This peptide or oligopeptide is studied for its ...
Eribulin: Oligopeptide Research Reference
Eribulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Erinaceins: Peptide Toxin in Pharmacology Reference
erinaceins is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...
ERK Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting ERK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Erythropoietin Hormone: Endogenous Peptide Hormone Reference
Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Erythropoietin Peptide Hormone
Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Erythropoietin Protein Hormone
Erythropoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Erythropoietin: Endogenous Peptide Hormone Reference
Glycoprotein hormone that stimulates red blood cell production through EPO receptor activation on erythroid progenitor cells.
Esculentin 1a: Antimicrobial Peptide Reference
esculentin-1a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...
Esculentin 2a: Antimicrobial Peptide Reference
esculentin-2a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...
Esculentin 2EM: Antimicrobial Peptide Reference
esculentin-2EM is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...
Esculentin-1: Antimicrobial Peptide Reference
Esculentin-1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Esculentin-2: Antimicrobial Peptide Reference
Esculentin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Esculentin: Antimicrobial Peptide Reference
Potent frog AMP active against Pseudomonas aeruginosa in wound infections. This antimicrobial peptide demonstrates activity against pathogens and is studied ...
ESM for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using ESM. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...
ESMFold for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using ESMFold. This analytical technique provides valuable insights into peptide structure, purity, and characte...
ESMFold: Oligopeptide Research Reference
ESMFold, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ESMFold2 for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using ESMFold2. This analytical technique provides valuable insights into peptide structure, purity, and charact...
ESMFold3 for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using ESMFold3. This analytical technique provides valuable insights into peptide structure, purity, and charact...
Esophageal Cancer Peptides: Comprehensive Peptide Reference
Peptides associated with Esophageal Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...
Essential Dynamics for Peptides
A computational method for studying peptides using Essential Dynamics. This analytical technique provides valuable insights into peptide structure, purity, a...
Ester Bonds in Peptides: Post-Translational Modification ...
Overview of ester bonds in depsipeptides and their role in cyclic peptide design. This modification affects peptide stability, receptor binding, and biologic...
Estradiol Hormone: Endogenous Peptide Hormone Reference
Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Estradiol Peptide Hormone: Comprehensive Peptide Reference
Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Estradiol Protein Hormone: Comprehensive Peptide Reference
Estradiol, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Eteplirsen: Oligopeptide Research Reference
Eteplirsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ethanol Precipitation Purification
A purification technique for separating and isolating peptides using Ethanol Precipitation. This analytical technique provides valuable insights into peptide...
Etorphine: Neuropeptide in Neuroscience Reference
Extremely potent semi-synthetic opioid for veterinary immobilization. This neuropeptide is involved in neurological signaling and is studied for its roles in...
EU Clinical Trials Register: Comprehensive Peptide Reference
Database of clinical trials conducted in the European Union. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...
European Peptide Symposium: Comprehensive Peptide Reference
European conference for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Evaporation Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Evaporation. This analytical technique provides valuable insights into peptide structure...
Everolimus: Oligopeptide Research Reference
Derivative of sirolimus that inhibits mTOR, used in transplant immunosuppression, oncology, and tuberous sclerosis treatment.
Evolution of Peptide Synthesis
Comprehensive reference for Evolution of Peptide Synthesis, a peptide compound with applications in research and therapeutics.
Evolution of Peptide Synthesis Methods
How peptide synthesis techniques evolved from solution-phase to solid-phase and beyond. This peptide or oligopeptide is studied for its biological activity, ...
Exenatide - DURATION-1 (NCT00207469)
Duration-1 trial comparing exenatide to glimepiride in type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Exenatide (Exendin-4): Oligopeptide Research Reference
Exenatide (Exendin-4), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Exenatide Extended Release: Comprehensive Peptide Reference
Once-weekly exenatide in poly(lactide-co-glycolide) microspheres for sustained 7-day release. This peptide or oligopeptide is studied for its biological acti...
Exenatide Once Weekly: Peptide Family Reference
Extended-release microsphere formulation of exenatide providing sustained GLP-1 receptor agonism with once-weekly dosing.
Exenatide Twice Daily: Peptide Family Reference
First-in-class short-acting GLP-1 receptor agonist derived from Gila monster exendin-4, administered twice daily. Covers molecular mechanisms, biological act...
Exenatide: Oligopeptide Research Reference
exenatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Exenatide: Oligopeptide Research Reference
First-in-class GLP-1 agonist from Gila monster saliva, twice-daily injection for type 2 diabetes. This peptide or oligopeptide is studied for its biological ...
Exendin-3: Oligopeptide Research Reference
39-aa peptide from Gila monster saliva. Related to exendin-4 but less potent at GLP-1 receptor. This peptide or oligopeptide is studied for its biological ac...
Exendin-4 (Exenatide): Oligopeptide Research Reference
Exendin-4 (Exenatide), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Exendin-4: Oligopeptide Research Reference
Exendin-4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Exosome Delivery: Oligopeptide Research Reference
Using exosomes as natural nanoparticles for peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Exosome Peptide Delivery: Oligopeptide Research Reference
Understand exosome-based nanocarriers for delivering therapeutic peptides across biological barriers. This peptide or oligopeptide is studied for its biologi...
Exosome: Oligopeptide Research Reference
Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...
exploratory-endpoint Resource: Comprehensive Peptide Refe...
The exploratory-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
exposure-response Resource: Comprehensive Peptide Reference
The exposure-response database or resource for peptide research, providing data on structure, function, and interactions.
Expressed Protein Ligation Synthesis
A peptide synthesis method using Expressed Protein Ligation for producing peptides with specific properties. This peptide or oligopeptide is studied for its ...
Extraction: Oligopeptide Research Reference
Extraction, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
extrusion for Peptides: Analytical Technique in Peptide R...
Application of extrusion technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bio...
Extrusion Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Extrusion for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Extrusome-mediated toxic discharge
Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
Eye Disease and Peptides: Oligopeptide Research Reference
Discover peptide therapeutics for ocular diseases including macular degeneration, glaucoma, and dry eye. This peptide or oligopeptide is studied for its biol...
Eyeseryl: Oligopeptide Research Reference
Acetyl tetrapeptide-5 (Ac-β-Ala-His-Ser-Ser). Reduces periorbital puffiness and dark circles. Inhibits glycation of collagen, increases lymphatic drainage, r...
F1-score Resource: Oligopeptide Research Reference
The F1-score database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Fab Conjugation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Fab Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Fab fragment: Oligopeptide Research Reference
Comprehensive reference for fab fragment, covering molecular structure, pharmacological properties, receptor interactions,
Fab System 1: Oligopeptide Research Reference
A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
Fab System 2: Oligopeptide Research Reference
A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
Fab System 3: Oligopeptide Research Reference
A Fab-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
Fabry Disease: Oligopeptide Research Reference
α-galactosidase A deficiency → GL-3 accumulation. Treatments: agalsidase, migalastat. This peptide or oligopeptide is studied for its biological activity, st...
Factor VIIa: Oligopeptide Research Reference
factor VIIa in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Factor Xa Cleavage Purification
A purification technique for separating and isolating peptides using Factor Xa Cleavage. This analytical technique provides valuable insights into peptide st...
Factor Xa Inhibitor: Enzyme in Peptide Biology Reference
factor Xa inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spe...
Farnesylated pheromone binds Map3p receptor
Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Farnesylated pheromone binds Ste3p GPCR receptor
Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Fasciculin 1: Peptide Toxin in Pharmacology Reference
fasciculin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...
Fasciculin 2: Peptide Toxin in Pharmacology Reference
fasciculin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologi...
Fasciola Peptides: Oligopeptide Research Reference
Fasciola Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Faster-Acting Insulin Aspart: Comprehensive Peptide Refer...
Next-generation rapid-acting insulin aspart formulation with niacinamide and L-arginine for accelerated initial absorption.
FastText for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using FastText. This analytical technique provides valuable insights into peptide structure, purity, and charact...
Fc Fusion System 1: Oligopeptide Research Reference
A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Fc Fusion System 2: Oligopeptide Research Reference
A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Fc Fusion System 3: Oligopeptide Research Reference
A Fc-fusion-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Fc fusion: Oligopeptide Research Reference
Comprehensive reference for fc fusion, covering molecular structure, pharmacological properties, receptor interactions,
FcRn Modulator: Oligopeptide Research Reference
FcRn modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
FDA Orange Book: Oligopeptide Research Reference
FDA database of approved drug products with therapeutic equivalence evaluations. This peptide or oligopeptide is studied for its biological activity, structu...
FDA Peptide Drug Approval: Comprehensive Peptide Reference
Navigate the FDA regulatory pathway for peptide drug approval including IND, NDA, and BLA submission requirements. Covers molecular mechanisms, biological ac...
Feather Keratin Peptides: Oligopeptide Research Reference
Comprehensive reference for Feather Keratin Peptides, a peptide compound with applications in research and therapeutics.
Feather Keratin-Derived Peptides
Comprehensive reference for Feather Keratin-Derived Peptides, a peptide compound with applications in research and therapeutics.
Feline Antimicrobial: Oligopeptide Research Reference
Feline Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Feline Beta-Defensin: Oligopeptide Research Reference
Feline Beta-Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Feline Cathelicidin: Oligopeptide Research Reference
Feline Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Feline Defensin: Oligopeptide Research Reference
Feline Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Feline Neutrophil Peptide: Comprehensive Peptide Reference
Comprehensive reference for Feline Neutrophil Peptide, a peptide compound with applications in research and therapeutics.
Feline Serum Peptide: Oligopeptide Research Reference
Feline Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fentanyl Synthetic Opioid: Comprehensive Peptide Reference
Potent synthetic opioid with rapid onset and short duration for anesthesia. This neuropeptide is involved in neurological signaling and is studied for its ro...
Fentanyl: Oligopeptide Research Reference
Fentanyl, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ferring: Oligopeptide Research Reference
Degarelix. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...
Ferritin: Oligopeptide Research Reference
Iron-storage protein. Inflammation marker, iron deficiency indicator. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Fertility and Peptides: Oligopeptide Research Reference
Discover gonadotropin peptides and GnRH analogs for treating infertility and reproductive disorders. This peptide or oligopeptide is studied for its biologic...
FFF Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using FFF. This analytical technique provides valuable insights into peptide structure, purity, and chara...
FGF 1 Hormone: Endogenous Peptide Hormone Reference
FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 1 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 1 Protein Hormone: Endogenous Peptide Hormone Reference
FGF 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 2 Hormone: Endogenous Peptide Hormone Reference
FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 2 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 2 Protein Hormone: Endogenous Peptide Hormone Reference
FGF 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 21 Hormone: Endogenous Peptide Hormone Reference
FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
FGF 21 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
FGF 21 Protein Hormone: Endogenous Peptide Hormone Reference
FGF 21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
FGF 7 Hormone: Endogenous Peptide Hormone Reference
FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 7 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF 7 Protein Hormone: Endogenous Peptide Hormone Reference
FGF 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting FGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
FGF21 1-100: Endogenous Peptide Hormone Reference
Comprehensive reference for FGF21 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,
FGF21 1-150: Endogenous Peptide Hormone Reference
Comprehensive reference for FGF21 1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,
FGF21 1-181: Endogenous Peptide Hormone Reference
Comprehensive reference for FGF21 1-181 variant, covering molecular structure, pharmacological properties, receptor interactions,
FGF21 100-181: Endogenous Peptide Hormone Reference
Comprehensive reference for FGF21 100-181 variant, covering molecular structure, pharmacological properties, receptor interactions,
FGF21 150-181: Endogenous Peptide Hormone Reference
Comprehensive reference for FGF21 150-181 variant, covering molecular structure, pharmacological properties, receptor interactions,
FGF21 Hormone: Endogenous Peptide Hormone Reference
FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF21 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF21 Protein Hormone: Endogenous Peptide Hormone Reference
FGF21, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF21: Structure, Function, and Significance
Fibroblast growth factor 21 is a metabolic hormone that regulates glucose uptake, lipid metabolism, and insulin sensitivity.
FGF23 Hormone: Endogenous Peptide Hormone Reference
FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF23 Peptide Hormone: Endogenous Peptide Hormone Reference
FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGF23 Protein Hormone: Endogenous Peptide Hormone Reference
FGF23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FGFR Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting FGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
FGFR Inhibitor: Oligopeptide Research Reference
FGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
FIA Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using FIA. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Fiasp Formulation Science: Comprehensive Peptide Reference
Formulation science behind faster insulin aspart including niacinamide vasodilation and citrate-mediated pH reduction. Covers molecular mechanisms, biologica...
Fiber Assembly System 1: Oligopeptide Research Reference
A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Fiber Assembly System 2: Oligopeptide Research Reference
A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Fiber Assembly System 3: Oligopeptide Research Reference
A fiber-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Fibrinogen → Fibrin (Thrombin Cleavage)
Comprehensive reference for Fibrinogen → Fibrin (Thrombin Cleavage), a peptide compound with applications in research and therapeutics.
Fibrinogen: Oligopeptide Research Reference
340 kDa glycoprotein (Aα, Bβ, γ)₂ hexamer. 340-aa Aα chains, 461-aa Bβ chains, 411-aa γ chains. Converted to fibrin by thrombin (cleaves fibrinopeptides A an...
Fibroblast Growth Factor 1-100
Comprehensive reference for fibroblast growth factor 1-100, covering molecular structure, pharmacological properties, receptor interactions,
Fibroblast Growth Factor 1-155
Comprehensive reference for fibroblast growth factor 1-155, covering molecular structure, pharmacological properties, receptor interactions,
Fibroblast Growth Factor 1-50: Comprehensive Peptide Refe...
Comprehensive reference for fibroblast growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,
Fibroblast Growth Factor Family
Overview of FGF family peptides in cell proliferation, development, and tissue repair. This peptide or oligopeptide is studied for its biological activity, s...
Fibroblast Growth Factor fragment-1-30
Comprehensive reference for fibroblast growth factor fragment-1-30, covering molecular structure, pharmacological properties, receptor interactions,
Fibroblast Growth Factor fragment-100-155
Comprehensive reference for fibroblast growth factor fragment-100-155, covering molecular structure, pharmacological properties, receptor interactions,
Fibroblast Growth Factor fragment-50-100
Comprehensive reference for fibroblast growth factor fragment-50-100, covering molecular structure, pharmacological properties, receptor interactions,
Fibroin Heavy Chain (Bombyx): Comprehensive Peptide Refer...
Comprehensive reference for Fibroin Heavy Chain (Bombyx), a peptide compound with applications in research and therapeutics.
Fibroin Light Chain (Bombyx): Comprehensive Peptide Refer...
Comprehensive reference for Fibroin Light Chain (Bombyx), a peptide compound with applications in research and therapeutics.
Fibromyalgia Peptides: Oligopeptide Research Reference
Peptides associated with Fibromyalgia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Fibronectin peptide: Structure, Function, and Significance
RGDS is a fibronectin-derived cell-adhesion peptide that binds integrins and is widely used in tissue engineering and biomaterials.
Filgrastim: Oligopeptide Research Reference
filgrastim in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Filgrastim: Oligopeptide Research Reference
Recombinant G-CSF that stimulates neutrophil production and mobilization for chemotherapy-induced neutropenia and stem cell collection.
Filipin: Oligopeptide Research Reference
Filipin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
filtration for Peptides: Analytical Technique in Peptide ...
Application of filtration technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...
Filtration Purification: Analytical Technique in Peptide ...
A purification technique for separating and isolating peptides using Filtration. This analytical technique provides valuable insights into peptide structure,...
Fish Antifreeze Peptide: Oligopeptide Research Reference
fish antifreeze peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Fish Antimicrobial: Oligopeptide Research Reference
Fish Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological...
Fish Beta-Defensin: Antimicrobial Peptide Reference
Mucosal defensin in fish skin and gills for aquatic innate immunity. This antimicrobial peptide demonstrates activity against pathogens and is studied for it...
Fish Bone Collagen: Oligopeptide Research Reference
fish bone collagen in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Fish Bone Peptides: Oligopeptide Research Reference
Fish Bone Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fish Collagen Peptides: Oligopeptide Research Reference
Fish Collagen Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fish Collagen: Oligopeptide Research Reference
Fish Collagen is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological acti...
Fish Gelatin: Oligopeptide Research Reference
Fish Gelatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fish Neuropeptide: Oligopeptide Research Reference
Fish Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ...
Fish Peptide Hormone: Oligopeptide Research Reference
Fish Peptide Hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Fish Piscidin: Antimicrobial Peptide Reference
AMP from fish gill and skin providing mucosal defense against aquatic pathogens. This antimicrobial peptide demonstrates activity against pathogens and is st...
Fish Scale Peptides: Oligopeptide Research Reference
Fish Scale Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fish Skin Peptides: Oligopeptide Research Reference
Fish Skin Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fish Venom: Oligopeptide Research Reference
Fish Venom is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...
Flag Tag Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using Flag Tag. This analytical technique provides valuable insights into peptide structure, p...
FLAG-tag → Anti-FLAG (Affinity Purification)
Comprehensive reference for FLAG-tag → Anti-FLAG (Affinity Purification), a peptide compound with applications in research and therapeutics.
Flatworm Parasitic / Liver Fluke
Flatworm Parasitic / Liver Fluke is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...
Flatworm Parasitic / Tapeworm: Comprehensive Peptide Refe...
Flatworm Parasitic / Tapeworm is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Flax Peptide: Oligopeptide Research Reference
A bioactive peptide derived from flax with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Flexal N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Flexal N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
flexibility Resource: Oligopeptide Research Reference
The flexibility database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Flow Chemistry Synthesis: Analytical Technique in Peptide...
A peptide synthesis method using Flow Chemistry for producing peptides with specific properties. This analytical technique provides valuable insights into pe...
Flow Chemistry Synthesis: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Flow Cytometry Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Flow Cytometry. This analytical technique provides valuable insights into peptide structure, purity...
Flow Cytometry for Peptides: Comprehensive Peptide Reference
Discover flow cytometry applications for peptide-MHC complex detection and peptide library screening. This peptide or oligopeptide is studied for its biologi...
Flt3L Hormone: Endogenous Peptide Hormone Reference
Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
Flt3L Peptide Hormone: Endogenous Peptide Hormone Reference
Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
Flt3L Protein Hormone: Endogenous Peptide Hormone Reference
Flt3L, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
FLU-v: Oligopeptide Research Reference
FLU-v, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
fluorescence for Peptides: Comprehensive Peptide Reference
Application of fluorescence technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...
Fluorescence Spectroscopy for Peptides
Learn fluorescence spectroscopy techniques for studying peptide conformation, interactions, and microenvironment changes.
Fluorescent Labeling Synthesis
A peptide synthesis method using Fluorescent Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Fmoc Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Fmoc for producing peptides with specific properties. This analytical technique provides valuable insights into peptide stru...
FMRFamide-related Peptides (C. elegans)
Comprehensive reference for FMRFamide-related Peptides (C. elegans), a peptide compound with applications in research and therapeutics.
foam for Peptides: Analytical Technique in Peptide Research
Application of foam technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...
Focal-adhesion Pathway Peptide 1
A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Focal-adhesion Pathway Peptide 2
A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Focal-adhesion Pathway Peptide 3
A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Focal-adhesion Pathway Peptide 4
A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Focal-adhesion Pathway Peptide 5
A peptide involved in the Focal-adhesion signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Foldseek Resource: Oligopeptide Research Reference
The Foldseek database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Follistatin Analog: Oligopeptide Research Reference
follistatin analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Follistatin: Receptor Pharmacology Reference
Follistatin is a protein with important roles in biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Food Bioactive Library food-bioactive-1
Comprehensive reference for food bioactive library food-bioactive-1, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-10
Comprehensive reference for food bioactive library food-bioactive-10, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-11
Comprehensive reference for food bioactive library food-bioactive-11, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-12
Comprehensive reference for food bioactive library food-bioactive-12, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-13
Comprehensive reference for food bioactive library food-bioactive-13, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-14
Comprehensive reference for food bioactive library food-bioactive-14, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-15
Comprehensive reference for food bioactive library food-bioactive-15, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-16
Comprehensive reference for food bioactive library food-bioactive-16, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-17
Comprehensive reference for food bioactive library food-bioactive-17, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-18
Comprehensive reference for food bioactive library food-bioactive-18, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-19
Comprehensive reference for food bioactive library food-bioactive-19, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-2
Comprehensive reference for food bioactive library food-bioactive-2, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-20
Comprehensive reference for food bioactive library food-bioactive-20, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-21
Comprehensive reference for food bioactive library food-bioactive-21, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-22
Comprehensive reference for food bioactive library food-bioactive-22, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-23
Comprehensive reference for food bioactive library food-bioactive-23, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-24
Comprehensive reference for food bioactive library food-bioactive-24, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-25
Comprehensive reference for food bioactive library food-bioactive-25, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-26
Comprehensive reference for food bioactive library food-bioactive-26, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-27
Comprehensive reference for food bioactive library food-bioactive-27, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-28
Comprehensive reference for food bioactive library food-bioactive-28, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-29
Comprehensive reference for food bioactive library food-bioactive-29, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-3
Comprehensive reference for food bioactive library food-bioactive-3, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-30
Comprehensive reference for food bioactive library food-bioactive-30, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-31
Comprehensive reference for food bioactive library food-bioactive-31, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-32
Comprehensive reference for food bioactive library food-bioactive-32, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-33
Comprehensive reference for food bioactive library food-bioactive-33, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-34
Comprehensive reference for food bioactive library food-bioactive-34, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-35
Comprehensive reference for food bioactive library food-bioactive-35, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-36
Comprehensive reference for food bioactive library food-bioactive-36, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-37
Comprehensive reference for food bioactive library food-bioactive-37, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-38
Comprehensive reference for food bioactive library food-bioactive-38, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-39
Comprehensive reference for food bioactive library food-bioactive-39, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-4
Comprehensive reference for food bioactive library food-bioactive-4, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-40
Comprehensive reference for food bioactive library food-bioactive-40, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-5
Comprehensive reference for food bioactive library food-bioactive-5, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-6
Comprehensive reference for food bioactive library food-bioactive-6, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-7
Comprehensive reference for food bioactive library food-bioactive-7, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-8
Comprehensive reference for food bioactive library food-bioactive-8, covering molecular structure, pharmacological properties, receptor interactions,
Food Bioactive Library food-bioactive-9
Comprehensive reference for food bioactive library food-bioactive-9, covering molecular structure, pharmacological properties, receptor interactions,
Food Preservation: Oligopeptide Research Reference
Use of antimicrobial peptides for food preservation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...
FOR-026: Oligopeptide Research Reference
Long-term stability. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
FOR-027: Oligopeptide Research Reference
Pulmonary, amorphous. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...
FOR-028: Oligopeptide Research Reference
Sustained release, targeting. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
FOR-029: Oligopeptide Research Reference
Membrane permeation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
FOR-030: Oligopeptide Research Reference
Local sustained delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Formulation (5 processes): Comprehensive Peptide Reference
Comprehensive reference for Formulation (5 processes), a peptide compound with applications in research and therapeutics.
FR901379: Oligopeptide Research Reference
FR901379, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fragment Condensation: Oligopeptide Research Reference
Fragment Condensation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fragment Molecular Orbital for Peptides
A computational method for studying peptides using Fragment Molecular Orbital. This analytical technique provides valuable insights into peptide structure, p...
Free Energy Perturbation for Peptides
A computational method for studying peptides using Free Energy Perturbation. This analytical technique provides valuable insights into peptide structure, pur...
Free PSA: Oligopeptide Research Reference
Unbound PSA. Free/total PSA ratio improves prostate cancer detection. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Freeze Drying Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Freeze Drying. This analytical technique provides valuable insights into peptide structu...
freeze-drying for Peptides: Comprehensive Peptide Reference
Application of freeze-drying technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its...
Fremanezumab: Oligopeptide Research Reference
Anti-CGRP monoclonal antibody for migraine prevention with monthly or quarterly dosing. This peptide or oligopeptide is studied for its biological activity, ...
FRET for Peptides: Analytical Technique in Peptide Research
Application of FRET technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...
Frog Skin Peptide Library: Comprehensive Peptide Reference
Library of AMPs from amphibian skin secretions for drug discovery. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...
Frog: Peptide Toxin in Pharmacology Reference
0.002 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...
FSH Analog: Oligopeptide Research Reference
FSH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
FSH Family Peptides: Oligopeptide Research Reference
Overview of follicle-stimulating hormone and related glycoprotein hormones in reproductive endocrinology. This peptide or oligopeptide is studied for its bio...
FSH Hormone: Endogenous Peptide Hormone Reference
FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
FSH Peptide Hormone: Endogenous Peptide Hormone Reference
FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
FSH Protein Hormone: Endogenous Peptide Hormone Reference
FSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
FTIR Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using FTIR. This analytical technique provides valuable insights into peptide structure, purity, and char...
FTIR Spectroscopy for Peptides
Learn FTIR spectroscopy techniques for analyzing peptide secondary structure through amide bond vibrations. This peptide or oligopeptide is studied for its b...
Fucoidan Peptides: Oligopeptide Research Reference
Fucoidan Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
fukui-function Resource: Oligopeptide Research Reference
The fukui-function database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Fumitremorgin C: Oligopeptide Research Reference
Fumitremorgin C, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Fungal Antibiotic / Antifungal
Fungal Antibiotic / Antifungal is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...
Fungal Antibiotic / Beta-lactam
Fungal Antibiotic / Beta-lactam is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Fungal Bioactive Peptide / ATPase Inhibitor
Fungal Bioactive Peptide / ATPase Inhibitor is a bioactive compound with applications in peptide research and therapeutics.
Fungal Bioactive Peptide / Insecticidal
Fungal Bioactive Peptide / Insecticidal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...
Fungal Bioactive Peptide / Ionophore
Fungal Bioactive Peptide / Ionophore is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...
Fungal Cyclopeptide / Alkaloid
Fungal Cyclopeptide / Alkaloid is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...
Fungal Cyclopeptide / Chemosensitizer
Fungal Cyclopeptide / Chemosensitizer is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...
Fungal Cyclopeptide / Ionophore
Fungal Cyclopeptide / Ionophore is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Fungal Cyclopeptide / Toxin: Comprehensive Peptide Reference
Fungal Cyclopeptide / Toxin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...
Fungal Lipopeptide / Antifungal
Fungal Lipopeptide / Antifungal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Fungal Peptide Toxin / Neurotoxin
Fungal Peptide Toxin / Neurotoxin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
G CSF Hormone: Endogenous Peptide Hormone Reference
G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
G CSF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting G CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
G CSF Peptide Hormone: Endogenous Peptide Hormone Reference
G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
G CSF Protein Hormone: Endogenous Peptide Hormone Reference
G CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
g-kg: Oligopeptide Research Reference
High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
G-protein coupled receptor: Comprehensive Peptide Reference
Comprehensive reference for g-protein coupled receptor, covering molecular structure, pharmacological properties, receptor interactions,
Gaba: Structure, Function, and Significance
Gamma-aminobutyric acid (GABA) is a neurotransmitter found in fermented foods that has anxiolytic and antihypertensive properties.
Gaduscidin 1: Oligopeptide Research Reference
Gaduscidin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gaduscidin 2: Oligopeptide Research Reference
Gaduscidin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Galanin-Related Peptide: Receptor Pharmacology Reference
Shorter galanin family peptide with distinct receptor selectivity. This neuropeptide is involved in neurological signaling and is studied for its roles in br...
Galanin: Neuropeptide in Neuroscience Reference
A 30-amino acid neuropeptide widely distributed in the brain and peripheral tissues, regulating appetite, pain, cognition, and neuroprotection through three ...
Galcanezumab: Oligopeptide Research Reference
Anti-CGRP monoclonal antibody for episodic and chronic migraine prevention. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Galleria Defensin: Antimicrobial Peptide Reference
Major AMP from greater wax moth hemolymph with gram-positive bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is...
Gallidermin: Antimicrobial Peptide Reference
gallidermin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Gallinacins: Oligopeptide Research Reference
Gallinacins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gallium Nitrate: Oligopeptide Research Reference
Metal-based therapeutic that inhibits iron-dependent enzymes and ribonucleotide reductase, used for cancer-related hypercalcemia.
Galpanin Peptides: Receptor Pharmacology Reference
Galanin-like peptides with distinct receptor selectivity and distribution. This neuropeptide is involved in neurological signaling and is studied for its rol...
Galsulfase: Oligopeptide Research Reference
Galsulfase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gambierdiscus toxicus: Oligopeptide Research Reference
Persistent Na+ channel activation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Gamma Bungarotoxin: Peptide Toxin in Pharmacology Reference
gamma-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharma...
Gamma-Endorphin: Neuropeptide in Neuroscience Reference
POMC-derived opioid with potential antipsychotic-like effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Ganirelix: Oligopeptide Research Reference
GnRH antagonist peptide used in IVF protocols to prevent premature LH surge during controlled ovarian stimulation. Covers molecular mechanisms, biological ac...
Garlic Allin: Oligopeptide Research Reference
garlic allin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Garlic Peptide: Oligopeptide Research Reference
A bioactive peptide derived from garlic with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
gas-phase-acidity Resource: Comprehensive Peptide Reference
The gas-phase-acidity database or resource for peptide research, providing data on structure, function, and interactions.
Gastric Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Gastric Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...
Gastrin (G-17): Neuropeptide in Neuroscience Reference
Gastrin (G-17), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gastrin 1-10: Peptide Fragment Reference
Comprehensive reference for gastrin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-13: Peptide Fragment Reference
Comprehensive reference for gastrin 1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-14: Peptide Fragment Reference
Comprehensive reference for gastrin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-17: Peptide Fragment Reference
Comprehensive reference for gastrin 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-34: Peptide Fragment Reference
Comprehensive reference for gastrin 1-34 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-4: Peptide Fragment Reference
Comprehensive reference for gastrin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-6: Peptide Fragment Reference
Comprehensive reference for gastrin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 1-8: Peptide Fragment Reference
Comprehensive reference for gastrin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 10-17: Peptide Fragment Reference
Comprehensive reference for gastrin 10-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 14-17: Peptide Fragment Reference
Comprehensive reference for gastrin 14-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin 5-17: Peptide Fragment Reference
Comprehensive reference for gastrin 5-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin Hormone: Endogenous Peptide Hormone Reference
Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Gastrin pentagastrin: Endogenous Peptide Hormone Reference
Comprehensive reference for gastrin pentagastrin variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin Peptide Hormone: Endogenous Peptide Hormone Refer...
Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Gastrin Protein Hormone: Endogenous Peptide Hormone Refer...
Gastrin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Gastrin tetragastrin: Endogenous Peptide Hormone Reference
Comprehensive reference for gastrin tetragastrin variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin trigastrin: Endogenous Peptide Hormone Reference
Comprehensive reference for gastrin trigastrin variant, covering molecular structure, pharmacological properties, receptor interactions,
Gastrin-Releasing Peptide: Comprehensive Peptide Reference
A 27-amino acid neuropeptide that is the mammalian homolog of amphibian bombesin, regulating gastrin release, growth, and serving as a biomarker for small ce...
Gastrin: Oligopeptide Research Reference
A gastrointestinal hormone that stimulates gastric acid secretion and growth of the gastric mucosa, existing in multiple forms including gastrin-14, gastrin-...
Gastroenterology: Oligopeptide Research Reference
Clinical trials for gastrointestinal diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
Gaucher Disease: Oligopeptide Research Reference
Glucocerebrosidase deficiency → glucocerebroside accumulation. Treatments: imiglucerase, eliglustat. This peptide or oligopeptide is studied for its biologic...
Gaussian Accelerated for Peptides
A computational method for studying peptides using Gaussian Accelerated. This analytical technique provides valuable insights into peptide structure, purity,...
GC MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using GC MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...
GC-C Agonist: Oligopeptide Research Reference
GC-C Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...
GDF 11 Hormone: Endogenous Peptide Hormone Reference
GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GDF 11 Peptide Hormone: Endogenous Peptide Hormone Reference
GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GDF 11 Protein Hormone: Endogenous Peptide Hormone Reference
GDF 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GDF 11: Endogenous Peptide Hormone Reference
GDF-11 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
GDF 8 Hormone: Endogenous Peptide Hormone Reference
GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GDF 8 Peptide Hormone: Endogenous Peptide Hormone Reference
GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GDF 8 Protein Hormone: Endogenous Peptide Hormone Reference
GDF 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GDF 8: Endogenous Peptide Hormone Reference
GDF-8 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis. Covers molecular mechanisms, biologic...
GDNF Analog: Oligopeptide Research Reference
GDNF analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
GDNF Hormone: Endogenous Peptide Hormone Reference
GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GDNF Peptide Hormone: Endogenous Peptide Hormone Reference
GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GDNF Protein Hormone: Endogenous Peptide Hormone Reference
GDNF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GDT-TS Resource: Oligopeptide Research Reference
The GDT-TS database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...
Gecko Cathelicidin: Oligopeptide Research Reference
Gecko Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gecko Defensin: Oligopeptide Research Reference
Gecko Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gecko Peptides: Oligopeptide Research Reference
Antimicrobial, Wound Healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Gecko Serum Antimicrobial Peptide
Comprehensive reference for Gecko Serum Antimicrobial Peptide, a peptide compound with applications in research and therapeutics.
Gecko Serum Peptide: Oligopeptide Research Reference
Gecko Serum Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gecko Skin Peptide: Oligopeptide Research Reference
Gecko Skin Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gecko Venom Peptide: Oligopeptide Research Reference
Gecko Venom Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
gel for Peptides: Analytical Technique in Peptide Research
Application of gel technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...
gel-electrophoresis for Peptides
Application of gel-electrophoresis technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological a...
Gelatin hydrolysate: Structure, Function, and Significance
Gelatin hydrolysate is a mixture of collagen-derived peptides with molecular weights of 2-5 kDa. It is used for joint health and skin elasticity.
Generative Adversarial for Peptides
A computational method for studying peptides using Generative Adversarial. This analytical technique provides valuable insights into peptide structure, purit...
Genitourinary Tract AMPs: Antimicrobial Peptide Reference
Antimicrobial peptides in genitourinary tract protecting against urogenital infections. This antimicrobial peptide demonstrates activity against pathogens an...
Geriatrics: Oligopeptide Research Reference
Special considerations for peptide drug use in elderly patients. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
GFAP intermediate filament: Comprehensive Peptide Reference
Comprehensive reference for gfap intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,
GFLGKFLGKFLG: Oligopeptide Research Reference
Paramecium tetraurelia. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
GFR Alpha 1 Agonist: Oligopeptide Research Reference
GFR alpha 1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
GHIH Hormone: Endogenous Peptide Hormone Reference
GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GHIH Peptide Hormone: Endogenous Peptide Hormone Reference
GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GHIH Protein Hormone: Endogenous Peptide Hormone Reference
GHIH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GHK-Cu: Oligopeptide Research Reference
Glycyl-L-histidyl-L-lysine copper complex. Wound healing, anti-aging. Stimulates collagen synthesis. This peptide or oligopeptide is studied for its biologic...
Ghrelin 1-10: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-14: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-2: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-2 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-28: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-4: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-6: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 1-8: Peptide Fragment Reference
Comprehensive reference for ghrelin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 10-28: Peptide Fragment Reference
Comprehensive reference for ghrelin 10-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 4-14: Peptide Fragment Reference
Comprehensive reference for ghrelin 4-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin 8-28: Peptide Fragment Reference
Comprehensive reference for ghrelin 8-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
Ghrelin Hormone: Endogenous Peptide Hormone Reference
Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Ghrelin Peptide Hormone: Endogenous Peptide Hormone Refer...
Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Ghrelin Protein Hormone: Endogenous Peptide Hormone Refer...
Ghrelin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Ghrelin: Endogenous Peptide Hormone Reference
28-amino acid orexigenic hormone from the stomach that stimulates growth hormone release and appetite through GHS-R signaling.
GHRH Analog: Oligopeptide Research Reference
GHRH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
GHRH Hormone: Endogenous Peptide Hormone Reference
GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GHRH Peptide Hormone: Endogenous Peptide Hormone Reference
GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GHRH Protein Hormone: Endogenous Peptide Hormone Reference
GHRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
GICWNCKNKGQYYCQC: Oligopeptide Research Reference
Saccharomyces kluyveri. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
GICWNCRNKGQYYCQCN: Oligopeptide Research Reference
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Gila Monster Venom Protein: Comprehensive Peptide Reference
Collection of bioactive peptides from Gila monster venom. Include exendin-4 and gilatoxin. This peptide or oligopeptide is studied for its biological activit...
Ginger Gingerol Peptide: Oligopeptide Research Reference
ginger gingerol peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Ginger Peptide: Oligopeptide Research Reference
A bioactive peptide derived from ginger with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Ginkbilobin: Oligopeptide Research Reference
Ginkbilobin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ginseng Peptide: Oligopeptide Research Reference
A bioactive peptide derived from ginseng with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
GIP → DPP-4 (Substrate): Oligopeptide Research Reference
GIP → DPP-4 (Substrate), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
GIP Hormone: Endogenous Peptide Hormone Reference
GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
GIP Peptide Hormone: Endogenous Peptide Hormone Reference
GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
GIP physiology, dual agonist design, incretin combination...
GIP physiology, dual agonist design, incretin combination... is a bioactive compound with applications in peptide research and therapeutics.
GIP Protein Hormone: Endogenous Peptide Hormone Reference
GIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
Glacontryphan M: Peptide Toxin in Pharmacology Reference
glacontryphan-M is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for ...
Glarea lozoyensis: Oligopeptide Research Reference
Inhibits β-1,3-glucan synthase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Glargine U300 Pharmacokinetics
Pharmacokinetic characterization of concentrated glargine 300 U/mL showing delayed absorption and constant 24-hour coverage.
Glatiramer Acetate: Oligopeptide Research Reference
Random copolymer peptide mixture that modulates immune response in multiple sclerosis, mimicking myelin basic protein. Covers molecular mechanisms, biologica...
Glatiramer: Oligopeptide Research Reference
glatiramer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
GLCGNCKNKGQYYCQC: Oligopeptide Research Reference
Tetrahymena pyriformis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
GLCNLCKNKGQYYCTCTD: Oligopeptide Research Reference
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
GLCYNCNKFGQYYCTC: Oligopeptide Research Reference
Pichia kluyveri. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...
Gliadin: Oligopeptide Research Reference
Gliadin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gliadorphin: Oligopeptide Research Reference
Opioid peptide derived from wheat gluten (gliadin). Sequence: Tyr-Pro-Gln-Pro-Gln. Found in gluten digests. May cross blood-brain barrier and affect neurotra...
Glioblastoma Peptides: Oligopeptide Research Reference
Peptides associated with Glioblastoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Gliotoxin: Oligopeptide Research Reference
Gliotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gliovac: Oligopeptide Research Reference
Gliovac, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Global Glargine Biosimilars: Comprehensive Peptide Reference
Review of global biosimilar insulin glargine landscape including Semglee, Abasaglar, and emerging biosimilars. This peptide or oligopeptide is studied for it...
GloVe for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using GloVe. This analytical technique provides valuable insights into peptide structure, purity, and characteri...
Gloverin (Hyalophora): Oligopeptide Research Reference
Gloverin (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
GLP 1 Hormone: Endogenous Peptide Hormone Reference
GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP 1 Peptide Hormone: Endogenous Peptide Hormone Reference
GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP 1 Protein Hormone: Endogenous Peptide Hormone Reference
GLP 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP 2 Hormone: Endogenous Peptide Hormone Reference
GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP 2 Peptide Hormone: Endogenous Peptide Hormone Reference
GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP 2 Protein Hormone: Endogenous Peptide Hormone Reference
GLP 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
GLP-1 → GLP-1R: Oligopeptide Research Reference
GLP-1 → GLP-1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
GLP-1 Adipose Tissue Effects: Comprehensive Peptide Refer...
Effects on lipolysis, adipokine secretion, and browning of white adipose tissue. This peptide or oligopeptide is studied for its biological activity, structu...
GLP-1 Agonist Cardiovascular Protection
Evidence for cardiovascular benefits of GLP-1 receptor agonists including reduced MACE and heart failure hospitalizations.
GLP-1 Agonist Combination Therapies
Rationale and evidence for combining GLP-1 receptor agonists with other glucose-lowering medications. This peptide or oligopeptide is studied for its biologi...
GLP-1 Agonist Diabetes Remission
Potential for GLP-1 receptor agonists to achieve type 2 diabetes remission through beta cell preservation and weight loss.
GLP-1 Agonist Gastric Emptying Effects
Effects of GLP-1 receptor agonists on gastric motility including delayed gastric emptying and its role in glycemic control.
GLP-1 Agonist Gastric Safety: Comprehensive Peptide Refer...
Safety profile of GLP-1 receptor agonists regarding gastric emptying, gastroparesis, and gastrointestinal tolerability. Covers molecular mechanisms, biologic...
GLP-1 Agonist Gastroparesis Management
Clinical management of gastroparesis-like symptoms during GLP-1 agonist therapy. This peptide or oligopeptide is studied for its biological activity, structu...
GLP-1 Agonist Immunogenicity: Comprehensive Peptide Refer...
Immunogenicity of GLP-1 receptor agonists including anti-drug antibody formation and clinical impact. This peptide or oligopeptide is studied for its biologi...
GLP-1 Agonist Impact on Obesity Epidemiology
Impact of GLP-1 receptor agonists on obesity treatment landscape and public health implications. This peptide or oligopeptide is studied for its biological a...
GLP-1 Agonist Market: Oligopeptide Research Reference
Market analysis for GLP-1 receptor agonists. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
GLP-1 Agonist Neuroprotective Effects
Evidence for neuroprotective and neurorestorative effects of GLP-1 receptor agonists in neurodegenerative diseases. Covers molecular mechanisms, biological a...
GLP-1 Agonist Overdose: Oligopeptide Research Reference
Excessive GLP-1 agonist dosing. Can cause severe hypoglycemia and pancreatitis. This peptide or oligopeptide is studied for its biological activity, structur...
GLP-1 Agonist Pancreatic Effects
Effects of GLP-1 receptor agonists on pancreatic beta cell function, insulin secretion, and glucagon suppression. Covers molecular mechanisms, biological act...
GLP-1 Agonist Pregnancy Safety
Safety considerations for GLP-1 receptor agonist use during pregnancy and current recommendations. This peptide or oligopeptide is studied for its biological...
GLP-1 Agonist Renal Effects: Comprehensive Peptide Reference
Nephroprotective effects of GLP-1 receptor agonists including reduced albuminuria and improved renal outcomes. This peptide or oligopeptide is studied for it...
GLP-1 Agonist Weight Loss Mechanisms
Multifaceted mechanisms by which GLP-1 receptor agonists induce weight loss including central appetite suppression. Covers molecular mechanisms, biological a...
GLP-1 Agonists in NASH/MASH Treatment
Efficacy of GLP-1 receptor agonists in nonalcoholic steatohepatitis including histological improvements. This peptide or oligopeptide is studied for its biol...
GLP-1 Albumin Binding Strategy
Fatty acid acylation strategy for albumin binding extending half-life through reduced renal clearance. This peptide or oligopeptide is studied for its biolog...
GLP-1 analog development, semaglutide oral formulation
GLP-1 analog development, semaglutide oral formulation is a bioactive compound with applications in peptide research and therapeutics.
GLP-1 and Alcohol Use: Oligopeptide Research Reference
Emerging evidence for effects on alcohol craving and potential alcohol use disorder treatment. This peptide or oligopeptide is studied for its biological act...
GLP-1 and Alzheimers: Oligopeptide Research Reference
Investigation of effects on amyloid pathology, tau phosphorylation, and cognitive decline. This peptide or oligopeptide is studied for its biological activit...
GLP-1 and Atrial Fibrillation: Comprehensive Peptide Refe...
Investigation of effects on atrial fibrillation risk and atrial remodeling in metabolic syndrome. This peptide or oligopeptide is studied for its biological ...
GLP-1 and CKD: Oligopeptide Research Reference
Renal outcomes data including albuminuria reduction and eGFR preservation in chronic kidney disease. This peptide or oligopeptide is studied for its biologic...
GLP-1 and Exendin-4 Receptor Cross-Reactivity
Comparison of native GLP-1 and Gila monster exendin-4 at the GLP-1 receptor including binding differences. This peptide or oligopeptide is studied for its bi...
GLP-1 and Heart Failure: Oligopeptide Research Reference
Benefits in heart failure with preserved ejection fraction including hemodynamic improvements. This peptide or oligopeptide is studied for its biological act...
GLP-1 and NAFLD: Oligopeptide Research Reference
Clinical evidence for efficacy in nonalcoholic fatty liver disease including steatosis reduction. This peptide or oligopeptide is studied for its biological ...
GLP-1 and Parkinsons: Oligopeptide Research Reference
Clinical trials evaluating neuroprotection including exenatide and lixisenatide studies. This peptide or oligopeptide is studied for its biological activity,...
GLP-1 and PCOS: Oligopeptide Research Reference
Emerging use in polycystic ovary syndrome for insulin sensitization and menstrual regulation. This peptide or oligopeptide is studied for its biological acti...
GLP-1 and Smoking Cessation: Comprehensive Peptide Reference
Investigation of effects on nicotine reward and potential adjunct for smoking cessation. This peptide or oligopeptide is studied for its biological activity,...
GLP-1 as DPP-4 Substrate: Peptide Family Reference
Mechanism of DPP-4-mediated GLP-1 degradation and how therapeutic analogues overcome this limitation. This peptide or oligopeptide is studied for its biologi...
GLP-1 Assay Cross-Reactivity: Comprehensive Peptide Refer...
Analytical considerations for immunoassay cross-reactivity with endogenous GLP-1 and metabolites. This peptide or oligopeptide is studied for its biological ...
GLP-1 Bone Effects: Oligopeptide Research Reference
Skeletal effects including bone formation promotion and fracture risk reduction in diabetes. This peptide or oligopeptide is studied for its biological activ...
GLP-1 Central Appetite Effects
Central nervous system effects of GLP-1 agonists including hypothalamic appetite suppression and reward modulation. Covers molecular mechanisms, biological a...
GLP-1 DPP-4 Resistance: Oligopeptide Research Reference
Structural modifications conferring DPP-4 resistance including Aib substitution and fatty acid acylation. This peptide or oligopeptide is studied for its bio...
GLP-1 Fatty Acid Conjugation Strategies
Chemical conjugation of fatty acid moieties to GLP-1 peptides for albumin binding and half-life extension. This peptide or oligopeptide is studied for its bi...
GLP-1 Fusion Protein Design: Comprehensive Peptide Reference
Engineering GLP-1 Fc fusion proteins and albumin fusions for extended half-life. This peptide or oligopeptide is studied for its biological activity, structu...
GLP-1 Gastroparesis: Oligopeptide Research Reference
Evaluation of delayed gastric emptying and clinical management of GI adverse effects. This peptide or oligopeptide is studied for its biological activity, st...
GLP-1 Hepatic Effects: Oligopeptide Research Reference
Hepatic effects on glucose production, lipid metabolism, and nonalcoholic fatty liver disease. This peptide or oligopeptide is studied for its biological act...
GLP-1 Hypoglycemia Risk: Oligopeptide Research Reference
Glucose-dependent mechanism providing low intrinsic hypoglycemia risk versus insulin. This peptide or oligopeptide is studied for its biological activity, st...
GLP-1 Immunomodulatory Effects
Immune-modulating properties including macrophage polarization and cytokine reduction. This peptide or oligopeptide is studied for its biological activity, s...
GLP-1 Nanoparticle Delivery: Comprehensive Peptide Reference
Nanoparticle encapsulation strategies including PLGA microspheres and lipid nanoparticles. This peptide or oligopeptide is studied for its biological activit...
GLP-1 Nausea Management: Oligopeptide Research Reference
Strategies for managing nausea including dose titration, dietary modifications, and antiemetics. This peptide or oligopeptide is studied for its biological a...
GLP-1 Nephroprotective Effects
Renal protective effects including natriuresis and glomerular hyperfiltration reduction. This peptide or oligopeptide is studied for its biological activity,...
GLP-1 Neuroprotective Effects: Comprehensive Peptide Refe...
Neuroprotective properties including neuroinflammation reduction and Alzheimer disease benefits. This peptide or oligopeptide is studied for its biological a...
GLP-1 Oral Bioavailability: Comprehensive Peptide Reference
Strategies for oral delivery including permeation enhancers, enzyme inhibitors, and mucoadhesive formulations. This peptide or oligopeptide is studied for it...
GLP-1 Pancreatitis Risk: Oligopeptide Research Reference
Evidence examining pancreatitis risk with GLP-1 agonist therapy in type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, stru...
GLP-1 PEGylation: Oligopeptide Research Reference
PEG conjugation for extending half-life while maintaining receptor binding and activation. This peptide or oligopeptide is studied for its biological activit...
GLP-1 Perioperative: Oligopeptide Research Reference
Management during surgery including aspiration risk assessment and glycemic control strategies. This peptide or oligopeptide is studied for its biological ac...
GLP-1 Receptor Agonist Market: Comprehensive Peptide Refe...
Market landscape and commercial analysis of GLP-1 receptor agonist drugs for diabetes and obesity. This therapeutic peptide is studied for its pharmacologica...
GLP-1 Receptor Agonist: Oligopeptide Research Reference
GLP-1 Receptor Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
GLP-1 Receptor Agonists: Oligopeptide Research Reference
GLP-1 receptor agonism, glucose-dependent insulin secretion, appetite suppression. This peptide or oligopeptide is studied for its biological activity, struc...
GLP-1 Receptor Antagonists: Comprehensive Peptide Reference
Development of GLP-1 receptor antagonists for research tools and potential therapeutic applications in obesity. Covers molecular mechanisms, biological activ...
GLP-1 Receptor Biased Agonism: Comprehensive Peptide Refe...
Concept of biased agonism at the GLP-1 receptor where different ligands preferentially activate specific signaling pathways.
GLP-1 Receptor Selectivity and Pharmacology
Structural basis of GLP-1 receptor activation and selectivity over related incretin receptors. This peptide or oligopeptide is studied for its biological act...
GLP-1 Receptor Signaling: Oligopeptide Research Reference
Intracellular signaling cascades activated by GLP-1 receptor including cAMP, PKA, and CREB pathways. This peptide or oligopeptide is studied for its biologic...
GLP-1 Receptor Structure: Analytical Technique in Peptide...
An analysis of the GLP-1 receptor cryo-EM structure, receptor activation mechanisms, and biased signaling pathways relevant to metabolic drug development.
GLP-1 Receptor Structure: Receptor Pharmacology Reference
Crystal structure and molecular pharmacology of GLP-1 receptor activation by peptide agonists. This peptide or oligopeptide is studied for its biological act...
GLP-1 Sarcopenia: Oligopeptide Research Reference
Lean mass loss concerns during weight reduction and strategies for preserving muscle mass. This peptide or oligopeptide is studied for its biological activit...
GLP-1 Skeletal Muscle Effects: Comprehensive Peptide Refe...
Effects on glucose uptake, mitochondrial function, and insulin sensitivity in muscle. This peptide or oligopeptide is studied for its biological activity, st...
GLP-1 Thyroid C-Cell Risk: Comprehensive Peptide Reference
Preclinical thyroid C-cell tumors in rodents and relevance assessment for human risk. This peptide or oligopeptide is studied for its biological activity, st...
GLP-1 Weight Loss Mechanism: Comprehensive Peptide Reference
Multi-organ mechanisms including central appetite suppression and peripheral energy expenditure. This peptide or oligopeptide is studied for its biological a...
GLP-1(7-36)amide: Peptide Family Reference
The primary bioactive form of GLP-1, a 30-amino acid peptide amide produced by intestinal L-cells. This peptide or oligopeptide is studied for its biological...
GLP-1/GIP/Glucagon Triple Agonists
Triple incretin receptor agonists simultaneously activating GLP-1, GIP, and glucagon receptors for maximal metabolic benefit.
GLP-1/Glucagon Dual Agonists: Comprehensive Peptide Refer...
Dual receptor agonists targeting both GLP-1 and glucagon receptors for enhanced metabolic effects including weight loss and hepatoprotection.
Glucagon 1-14: Peptide Fragment Reference
Comprehensive reference for glucagon 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-15: Peptide Fragment Reference
Comprehensive reference for glucagon 1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-16: Peptide Fragment Reference
Comprehensive reference for glucagon 1-16 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-17: Peptide Fragment Reference
Comprehensive reference for glucagon 1-17 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-18: Peptide Fragment Reference
Comprehensive reference for glucagon 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-19: Peptide Fragment Reference
Comprehensive reference for glucagon 1-19 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-20: Peptide Fragment Reference
Comprehensive reference for glucagon 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-21: Peptide Fragment Reference
Comprehensive reference for glucagon 1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-22: Peptide Fragment Reference
Comprehensive reference for glucagon 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-23: Peptide Fragment Reference
Comprehensive reference for glucagon 1-23 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-24: Peptide Fragment Reference
Comprehensive reference for glucagon 1-24 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-25: Peptide Fragment Reference
Comprehensive reference for glucagon 1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-26: Peptide Fragment Reference
Comprehensive reference for glucagon 1-26 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-27: Peptide Fragment Reference
Comprehensive reference for glucagon 1-27 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-28: Peptide Fragment Reference
Comprehensive reference for glucagon 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon 1-29: Peptide Fragment Reference
Comprehensive reference for glucagon 1-29 variant, covering molecular structure, pharmacological properties, receptor interactions,
Glucagon Family Peptides: Oligopeptide Research Reference
Overview of glucagon family peptides including glucagon, GLP-1, GLP-2, GIP, and secretin in metabolic regulation. Covers molecular mechanisms, biological act...
Glucagon Hormone: Endogenous Peptide Hormone Reference
Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Glucagon Peptide Hormone: Endogenous Peptide Hormone Refe...
Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Glucagon Protein Hormone: Endogenous Peptide Hormone Refe...
Glucagon, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Glucagon-Like Peptide-1: Oligopeptide Research Reference
Glucagon-like peptide-1 (GLP-1) is a 30-amino acid incretin hormone that enhances glucose-dependent insulin secretion and serves as the basis for widely pres...
Glucagon: Oligopeptide Research Reference
A 29-amino acid peptide hormone from pancreatic α-cells that promotes glycogenolysis and gluconeogenesis, serving as the primary counter-regulatory hormone t...
Glucanase Plant: Oligopeptide Research Reference
glucanase plant in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Glutamate Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Glutamate including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...
Glutamate Modification: Post-Translational Modification R...
Post-translational modifications of Glutamate including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...
Glutamate Peptide: Oligopeptide Research Reference
Glutamate (E) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...
Glutamine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Glutamine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...
Glutamine Modification: Post-Translational Modification R...
Post-translational modifications of Glutamine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...
Glutamine Peptide: Oligopeptide Research Reference
Glutamine (Q) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...
Glutathione (γ-Glu-Cys-Gly Tripeptide)
Comprehensive reference for Glutathione (γ-Glu-Cys-Gly Tripeptide), a peptide compound with applications in research and therapeutics.
Glutathione Oxidized: Oligopeptide Research Reference
glutathione oxidized in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Glutathione Peroxidase Mimetic
glutathione peroxidase mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
Glutathione: The Master Antioxidant
glutathione (GSH), the most abundant tripeptide in mammalian cells, covering molecular structure, biosynthesis, redox chemistry, and clinical significance
Gluten Exorphin: Oligopeptide Research Reference
Opioid peptides derived from wheat gluten. Multiple forms (glutenexorphin A5, B5, C5). May affect brain function and behavior. Potential role in gluten sensi...
Glutenin: Oligopeptide Research Reference
Glutenin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Glycine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Glycine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...
Glycine Modification: Post-Translational Modification Ref...
Post-translational modifications of Glycine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...
Glycine Peptide: Oligopeptide Research Reference
Glycine (G) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...
Glycopeptides: Oligopeptide Research Reference
Cell wall synthesis inhibition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Glycosidic Bonds in Glycopeptides
Explore glycosidic bond formation in glycopeptide conjugates and glycoprotein engineering. This modification affects peptide stability, receptor binding, and...
Glycosylation: Oligopeptide Research Reference
Addition of carbohydrate groups to proteins. Affects folding, stability, activity. This peptide or oligopeptide is studied for its biological activity, struc...
GM CSF Hormone: Endogenous Peptide Hormone Reference
GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GM CSF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting GM CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...
GM CSF Peptide Hormone: Endogenous Peptide Hormone Reference
GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GM CSF Protein Hormone: Endogenous Peptide Hormone Reference
GM CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
GMP for Peptide Manufacturing: Comprehensive Peptide Refe...
Learn Good Manufacturing Practice requirements specific to peptide drug substance and product manufacturing facilities. Covers molecular mechanisms, biologic...
GNCNTACGUWC: Oligopeptide Research Reference
Cylindrospermopsis raciborskii. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
GnIH: Oligopeptide Research Reference
GnIH in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
GnRH (Gonadotropin-releasing hormone)
Comprehensive reference for GnRH (Gonadotropin-releasing hormone), a peptide compound with applications in research and therapeutics.
GnRH → GnRHR: Oligopeptide Research Reference
GnRH → GnRHR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
GnRH Agonist Overdose: Oligopeptide Research Reference
Excessive GnRH agonist dosing. Can cause severe hormone suppression. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
GnRH Agonist: Oligopeptide Research Reference
GnRH agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
GnRH Family Peptides: Oligopeptide Research Reference
Overview of gonadotropin-releasing hormone family peptides in reproductive axis regulation. This peptide or oligopeptide is studied for its biological activi...
GnRH Modulators: Oligopeptide Research Reference
GnRH receptor agonists and antagonists. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Goblet Cell Secreted Peptide: Comprehensive Peptide Refer...
Mucin-associated antimicrobial peptide from goblet cells in mucus layer defense. This antimicrobial peptide demonstrates activity against pathogens and is st...
Gold Nanoparticle Labeling Synthesis
A peptide synthesis method using Gold Nanoparticle Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its ...
Golimumab: Oligopeptide Research Reference
golimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Golodirsen: Oligopeptide Research Reference
Golodirsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Gonadotropin-Releasing Hormone
Decapeptide hypothalamic hormone controlling gonadotropin release. This neuropeptide is involved in neurological signaling and is studied for its roles in br...
Goose Beta-Defensin (AcBD): Comprehensive Peptide Reference
Comprehensive reference for Goose Beta-Defensin (AcBD), a peptide compound with applications in research and therapeutics.
Goose Cathelicidin: Oligopeptide Research Reference
Goose Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Goose Defensin: Oligopeptide Research Reference
Goose Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Goserelin Implant Technology: Comprehensive Peptide Refer...
Biodegradable Zoladex implant technology providing sustained GnRH agonist release for hormone-dependent conditions. Covers molecular mechanisms, biological a...
Goserelin Implant: Oligopeptide Research Reference
Goserelin Implant, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Goserelin: Oligopeptide Research Reference
goserelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Goserelin: Oligopeptide Research Reference
Sustained-release GnRH agonist depot for prostate cancer, endometriosis, and breast cancer. This peptide or oligopeptide is studied for its biological activi...
GPCR-mediated mating response: Comprehensive Peptide Refe...
Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
GPI Anchors on Peptides: Post-Translational Modification ...
Guide to glycosylphosphatidylinositol anchors linking peptides to cell membranes. This modification affects peptide stability, receptor binding, and biologic...
GPT for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using GPT. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...
Gramicidin A: Antimicrobial Peptide Reference
Linear pentadecapeptide that forms monovalent cation channels in bacterial membranes, component of topical antimicrobial preparations.
Gramicidin A: Antimicrobial Peptide Reference
Gramicidin A is a linear 15-amino acid peptide antibiotic from Bacillus brevis that forms cation-selective ion channels in bacterial membranes.
Gramicidin D: Antimicrobial Peptide Reference
Mixture of linear pentadecapeptides from Bacillus brevis that form ion channels in bacterial membranes for topical antimicrobial use.
Gramicidin S: Antimicrobial Peptide Reference
Cyclic decapeptide antibiotic from Bacillus brevis that disrupts bacterial membranes through amphipathic beta-sheet structure.
Gramicidin S1: Antimicrobial Peptide Reference
gramicidin-S1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Gramicidin S2: Antimicrobial Peptide Reference
gramicidin-S2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Granisetron: Oligopeptide Research Reference
granisetron in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
GRANITE: Oligopeptide Research Reference
GRANITE, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Granulysin Antimicrobial: Antimicrobial Peptide Reference
Cytotoxic granule protein with direct activity against intracellular bacteria. This antimicrobial peptide demonstrates activity against pathogens and is stud...
Grape Peptide: Oligopeptide Research Reference
A bioactive peptide derived from grape with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Grapefruit Peptide: Oligopeptide Research Reference
A bioactive peptide derived from grapefruit with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Green Chemistry: Oligopeptide Research Reference
Sustainable chemistry approaches to peptide synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...
Green-tea Peptide: Oligopeptide Research Reference
A bioactive peptide derived from green-tea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
Growth Differentiation Factor GDF-1
Comprehensive reference for growth differentiation factor GDF-1, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-10
Comprehensive reference for growth differentiation factor GDF-10, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-11
Comprehensive reference for growth differentiation factor GDF-11, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-15
Comprehensive reference for growth differentiation factor GDF-15, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-16
Comprehensive reference for growth differentiation factor GDF-16, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-2
Comprehensive reference for growth differentiation factor GDF-2, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-3
Comprehensive reference for growth differentiation factor GDF-3, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-5
Comprehensive reference for growth differentiation factor GDF-5, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-6
Comprehensive reference for growth differentiation factor GDF-6, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-7
Comprehensive reference for growth differentiation factor GDF-7, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-8
Comprehensive reference for growth differentiation factor GDF-8, covering molecular structure, pharmacological properties, receptor interactions,
Growth Differentiation Factor GDF-9
Comprehensive reference for growth differentiation factor GDF-9, covering molecular structure, pharmacological properties, receptor interactions,
Growth Disorders and Peptides: Comprehensive Peptide Refe...
Explore growth hormone and IGF-1 peptide therapies for treating growth hormone deficiency and dwarfism. This peptide or oligopeptide is studied for its biolo...
Growth Hormone Family Peptides
Comprehensive guide to growth hormone family peptides including GH, prolactin, and placental lactogen. This peptide or oligopeptide is studied for its biolog...
Growth Hormone Releasing Peptides
Synthetic hexapeptides that stimulate growth hormone release through the ghrelin receptor, distinct from GHRH pathway. Covers molecular mechanisms, biologica...
Growth Hormone-Releasing Hormone
A 44-amino acid hypothalamic peptide that stimulates growth hormone secretion from the anterior pituitary via the GHRH receptor.
Growth Hormone-Releasing Hormone
Hypothalamic peptide stimulating growth hormone release from anterior pituitary. This neuropeptide is involved in neurological signaling and is studied for i...
GsAF-IV: Peptide Toxin in Pharmacology Reference
GsAF-IV, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
GSK: Oligopeptide Research Reference
Albiglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...
GsMTx 4: Peptide Toxin in Pharmacology Reference
GsMTx-4 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...
GST Tag Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using GST Tag. This analytical technique provides valuable insights into peptide structure, pu...
GST-tag → Glutathione (Affinity Purification)
Comprehensive reference for GST-tag → Glutathione (Affinity Purification), a peptide compound with applications in research and therapeutics.
GTEx: Oligopeptide Research Reference
Genotype-Tissue Expression database for studying gene expression across tissues. This peptide or oligopeptide is studied for its biological activity, structu...
Guanarito N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Guanarito N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-act...
Guanylate Cyclase-C Agonist: Comprehensive Peptide Reference
Guanylate Cyclase-C Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...
Guselkumab: Oligopeptide Research Reference
guselkumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Gut Disorders and Peptides: Comprehensive Peptide Reference
Explore peptide therapies for gastrointestinal conditions including IBD, Crohn's disease, and motility disorders. Covers molecular mechanisms, biological act...
Gyromitrin: Oligopeptide Research Reference
Gyromitrin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
H Pylori Peptide: Oligopeptide Research Reference
A peptide associated with H Pylori for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
H-bond-network Resource: Oligopeptide Research Reference
The H-bond-network database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
HA Tag Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using HA Tag. This analytical technique provides valuable insights into peptide structure, pur...
HA-tag → Anti-HA (Affinity Purification)
Comprehensive reference for HA-tag → Anti-HA (Affinity Purification), a peptide compound with applications in research and therapeutics.
Hair Growth: Oligopeptide Research Reference
Peptide-based approaches to hair growth. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Half Life Extension System 1: Comprehensive Peptide Refer...
A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...
Half Life Extension System 2: Comprehensive Peptide Refer...
A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...
Half Life Extension System 3: Comprehensive Peptide Refer...
A half-life-extension-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key c...
Half-life extension: Oligopeptide Research Reference
Comprehensive reference for half-life extension, covering molecular structure, pharmacological properties, receptor interactions,
Halichondrin B: Oligopeptide Research Reference
Halichondrin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Halovir A: Oligopeptide Research Reference
Halovir A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Handbook of Biologically Active Peptides
Comprehensive reference handbook covering all aspects of peptide biology. This peptide or oligopeptide is studied for its biological activity, structure-acti...
HAT Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HAT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Hazelnut Peptide: Oligopeptide Research Reference
A bioactive peptide derived from hazelnut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
HbA1c: Oligopeptide Research Reference
HbA1c, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
HBsAg Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HBsAg for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
HBsAg: Oligopeptide Research Reference
HBsAg is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity...
HBV HBsAg Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HBV HBsAg for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
HBV Peptide Vaccine: Oligopeptide Research Reference
HBV Peptide Vaccine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
HCAP 18: Antimicrobial Peptide Reference
hCAP-18 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...
HCG Analog: Oligopeptide Research Reference
hCG analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
HCG Hormone: Endogenous Peptide Hormone Reference
HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HCG Peptide Hormone: Endogenous Peptide Hormone Reference
HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HCG Protein Hormone: Endogenous Peptide Hormone Reference
HCG, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HCV E1E2 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HCV E1E2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
HCV Peptide Vaccine: Oligopeptide Research Reference
HCV Peptide Vaccine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
HDAC Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HDAC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
HDM2 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HDM2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
HdTx1: Peptide Toxin in Pharmacology Reference
HdTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...
Head Neck Cancer Peptides: Comprehensive Peptide Reference
Peptides associated with Head Neck Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its ...
Head-to-Tail Cyclization: Oligopeptide Research Reference
Formation of peptide bond between N-terminal and C-terminus. Creates cyclic peptides. This peptide or oligopeptide is studied for its biological activity, st...
Health Economics of Peptide Therapeutics: Cost-Effectiven...
Analyze the economic aspects of peptide drug development, pricing, reimbursement, and patient access. This peptide or oligopeptide is studied for its biologi...
Heart Failure and Peptides: Comprehensive Peptide Reference
Discover natriuretic peptides and other peptide therapies for managing heart failure and cardiovascular dysfunction. Covers molecular mechanisms, biological ...
Heart Failure Peptides: Oligopeptide Research Reference
Peptides associated with Heart Failure including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...
Heart Failure: Oligopeptide Research Reference
Cardiac impairment syndrome. HFrEF, HFpEF, HFmrEF. Treatments: ACEi/ARB/ARNI, beta-blockers, MRA, SGLT2i, devices. Covers molecular mechanisms, biological ac...
Hedgehog Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Hedgehog Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...
Hedgehog Modulator: Oligopeptide Research Reference
Hedgehog modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Hedgehog Pathway Peptide 1: Comprehensive Peptide Reference
A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hedgehog Pathway Peptide 2: Comprehensive Peptide Reference
A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hedgehog Pathway Peptide 3: Comprehensive Peptide Reference
A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hedgehog Pathway Peptide 4: Comprehensive Peptide Reference
A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hedgehog Pathway Peptide 5: Comprehensive Peptide Reference
A peptide involved in the Hedgehog signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Helicase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Helicase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Helix Assembly System 1: Oligopeptide Research Reference
A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Helix Assembly System 2: Oligopeptide Research Reference
A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Helix Assembly System 3: Oligopeptide Research Reference
A helix-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Helodermin: Oligopeptide Research Reference
35-aa peptide from Gila monster venom. VIP-like peptide with potent vasodilatory effects. This peptide or oligopeptide is studied for its biological activity...
Helospectin I: Oligopeptide Research Reference
35-aa VIP-related peptide from Gila monster venom. Vasodilatory and secretory effects. This peptide or oligopeptide is studied for its biological activity, s...
Helospectin II: Oligopeptide Research Reference
27-aa VIP-related peptide from Gila monster venom. Similar to helospectin I but shorter. This peptide or oligopeptide is studied for its biological activity,...
Hematology / TPO Mimetic: Oligopeptide Research Reference
Hematology / TPO Mimetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Hematology: Oligopeptide Research Reference
Clinical trials for blood disorders. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Hematotoxicity: Oligopeptide Research Reference
Blood-related adverse effects of peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Hemokinin 1: Neuropeptide in Neuroscience Reference
hemokinin-1 is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biologi...
Hemostasis / Coagulation: Oligopeptide Research Reference
Hemostasis / Coagulation is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Hemp Peptide: Oligopeptide Research Reference
A bioactive peptide derived from hemp with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Hendra F Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Hendra F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Heparin Affinity Purification: Comprehensive Peptide Refe...
A purification technique for separating and isolating peptides using Heparin Affinity. This analytical technique provides valuable insights into peptide stru...
Heparin: Oligopeptide Research Reference
heparin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
Hepatic Impairment: Oligopeptide Research Reference
Considerations for peptide drug dosing in patients with liver disease. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Hepatitis and Peptides: Oligopeptide Research Reference
Discover peptide antiviral approaches for hepatitis B and C treatment including direct-acting peptide inhibitors. Covers molecular mechanisms, biological act...
Hepatitis B Peptides: Oligopeptide Research Reference
Peptides associated with Hepatitis B including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Hepatitis C Peptides: Oligopeptide Research Reference
Peptides associated with Hepatitis C including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Hepatitis Peptides: Oligopeptide Research Reference
Peptides associated with Hepatitis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...
Hepatitis: Oligopeptide Research Reference
HBV/HCV liver infection. Treatments: entecavir/tenofovir (HBV), sofosbuvir (HCV). This peptide or oligopeptide is studied for its biological activity, struct...
Hepatotoxicity: Oligopeptide Research Reference
Liver damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Hepcidin 20: Endogenous Peptide Hormone Reference
hepcidin-20 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Hepcidin 22: Endogenous Peptide Hormone Reference
hepcidin-22 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Hepcidin 25: Endogenous Peptide Hormone Reference
hepcidin-25 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Hepcidin Hormone: Endogenous Peptide Hormone Reference
Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Hepcidin Peptide Hormone: Endogenous Peptide Hormone Refe...
Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Hepcidin Protein Hormone: Endogenous Peptide Hormone Refe...
Hepcidin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Hepcidin: Receptor Pharmacology Reference
Hepcidin is a peptide with important roles in biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
HER2 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HER2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
HER2 Inhibitor: Oligopeptide Research Reference
HER2 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Herpes Peptides: Oligopeptide Research Reference
Peptides associated with Herpes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Hevein: Oligopeptide Research Reference
Hevein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
HGF Hormone: Endogenous Peptide Hormone Reference
HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
HGF Peptide Hormone: Endogenous Peptide Hormone Reference
HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HGF Protein Hormone: Endogenous Peptide Hormone Reference
HGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
HIC HPLC Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using HIC HPLC. This analytical technique provides valuable insights into peptide structure, p...
HIC Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using HIC. This analytical technique provides valuable insights into peptide structure, purity...
High-performance liquid chromatography
HbA1c, small molecules. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
High-Throughput Screening: Comprehensive Peptide Reference
Automated testing of large peptide libraries for biological activity. This peptide or oligopeptide is studied for its biological activity, structure-activity...
High: Oligopeptide Research Reference
Predictions. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...
Hippo Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hippo Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hippo Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hippo Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hippo Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the Hippo signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Hirudin HV1: Oligopeptide Research Reference
Hirudin HV1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hirudin HV2: Oligopeptide Research Reference
Hirudin HV2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hirudin HV3: Oligopeptide Research Reference
Hirudin HV3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hirudin: Oligopeptide Research Reference
65-amino acid thrombin inhibitor from medicinal leeches, the most potent natural anticoagulant with bivalent thrombin binding.
His Tag Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using His Tag. This analytical technique provides valuable insights into peptide structure, pu...
His-tag → Ni-NTA (Affinity Purification)
Comprehensive reference for His-tag → Ni-NTA (Affinity Purification), a peptide compound with applications in research and therapeutics.
Histatin 1: Antimicrobial Peptide Reference
Major salivary histatin contributing to oral mucosal defense against fungal pathogens. This antimicrobial peptide demonstrates activity against pathogens and...
Histatin 5: Antimicrobial Peptide Reference
Salivary antimicrobial peptide with potent antifungal activity against Candida albicans. This antimicrobial peptide demonstrates activity against pathogens a...
Histidine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Histidine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...
Histidine Modification: Post-Translational Modification R...
Post-translational modifications of Histidine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...
Histidine Peptide: Oligopeptide Research Reference
Histidine (H) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...
Histone modification: Oligopeptide Research Reference
Comprehensive reference for histone modification, covering molecular structure, pharmacological properties, receptor interactions,
Histone-Derived Peptide (Crocodilian)
Comprehensive reference for Histone-Derived Peptide (Crocodilian), a peptide compound with applications in research and therapeutics.
History of Antimicrobial Peptide Research
The discovery and development of antimicrobial peptides from defensins to clinical candidates. This antimicrobial peptide demonstrates activity against patho...
History of Combinatorial Peptide Libraries
The development of combinatorial chemistry for peptide library screening and drug discovery. This peptide or oligopeptide is studied for its biological activ...
History of Insulin Discovery: Comprehensive Peptide Refer...
Tracing the discovery and development of insulin from Banting and Best to modern analogs. This endogenous peptide hormone plays important roles in physiologi...
History of Mass Spectrometry: Comprehensive Peptide Refer...
From Thomson and Aston to modern proteomics, the evolution of mass spectrometry for peptides. This peptide or oligopeptide is studied for its biological acti...
History of NMR Spectroscopy: Comprehensive Peptide Reference
The development of NMR spectroscopy for peptide structure determination and dynamics. This peptide or oligopeptide is studied for its biological activity, st...
History of Peptide Biomarker Development
How peptide biomarkers were discovered and validated for clinical diagnostics. This peptide or oligopeptide is studied for its biological activity, structure...
History of Peptide Clinical Development
The evolution of peptide drugs through clinical trials from insulin to modern therapeutics. This peptide or oligopeptide is studied for its biological activi...
History of Peptide Diagnostics
How peptide-based diagnostic assays evolved from immunoassays to modern biomarker testing. This peptide or oligopeptide is studied for its biological activit...
History of Peptide Drug Conjugates
The evolution of peptide-drug conjugates from early concepts to approved therapies. This peptide or oligopeptide is studied for its biological activity, stru...
History of Peptide Drug Delivery
The evolution of peptide delivery from injections to oral, nasal, and transdermal systems. This peptide or oligopeptide is studied for its biological activit...
History of Peptide Formulation Science
The development of formulation strategies for peptide stability and delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
History of Peptide Hormone Research
The discovery and characterization of peptide hormones from insulin to GLP-1. This peptide or oligopeptide is studied for its biological activity, structure-...
History of Peptide Receptor Discovery
How peptide receptors were identified and characterized over the past century. This peptide or oligopeptide is studied for its biological activity, structure...
History of Peptide Regulation: Comprehensive Peptide Refe...
How regulatory frameworks for peptide drugs evolved from early insulin to modern CMC guidelines. This peptide or oligopeptide is studied for its biological a...
History of Peptide Structure Determination
Methods used to determine peptide 3D structures from X-ray to cryo-EM. This peptide or oligopeptide is studied for its biological activity, structure-activit...
History of Peptide Synthesis: Comprehensive Peptide Refer...
The evolution of peptide synthesis from early solution-phase methods to modern SPPS and automation. This peptide or oligopeptide is studied for its biologica...
History of Peptide Therapeutics
From insulin to modern GLP-1 agonists, the evolution of peptide drugs over a century. This peptide or oligopeptide is studied for its biological activity, st...
History of Peptide Vaccine Development
Milestones in peptide vaccine technology from epitope mapping to neoantigen vaccines. This peptide or oligopeptide is studied for its biological activity, st...
History of Peptide Vaccines: Comprehensive Peptide Reference
The development of peptide-based vaccines from early epitope mapping to neoantigen approaches. This peptide or oligopeptide is studied for its biological act...
History of Peptide-GLP-1 Development
The journey from GLP-1 discovery to blockbuster diabetes and obesity drugs. This peptide or oligopeptide is studied for its biological activity, structure-ac...
History of X-ray Crystallography
How X-ray crystallography enabled atomic-resolution peptide and protein structure determination. This peptide or oligopeptide is studied for its biological a...
Histrelin Implant: Oligopeptide Research Reference
Histrelin Implant, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Histrelin: Oligopeptide Research Reference
Year-long subcutaneous GnRH agonist implant for central precocious puberty. This peptide or oligopeptide is studied for its biological activity, structure-ac...
HIV and Peptides: Oligopeptide Research Reference
Learn about peptide-based HIV therapies including fusion inhibitors and entry blockers for viral suppression. This peptide or oligopeptide is studied for its...
HIV Gp41 MPER Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HIV Gp41 MPER for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...
HIV Gp41 MPER: Oligopeptide Research Reference
HIV-gp41-MPER is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...
Hiv Peptides: Oligopeptide Research Reference
Peptides associated with Hiv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...
HIV V2 Loop: Oligopeptide Research Reference
HIV-V2-loop is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ac...
HIV V2 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HIV V2 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...
HIV/AIDS: Oligopeptide Research Reference
HIV-1/2 → CD4+ T-cell depletion. Treatments: ART (NRTIs, NNRTIs, INSTIs, PIs). This peptide or oligopeptide is studied for its biological activity, structure...
HNTX I: Peptide Toxin in Pharmacology Reference
HNTX-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...
HNTX IV: Peptide Toxin in Pharmacology Reference
HNTX-IV is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...
Hollow Microneedle Peptide: Comprehensive Peptide Reference
Hollow microneedle devices enabling liquid peptide formulation delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...
HOMO-LUMO Resource: Oligopeptide Research Reference
The HOMO-LUMO database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Homocarnosine: Oligopeptide Research Reference
homocarnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Homocystinuria: Oligopeptide Research Reference
CBS deficiency. Elevated homocysteine. Treatments: B6, betaine, low-methionine diet. This peptide or oligopeptide is studied for its biological activity, str...
Homology Modeling for Peptides
A computational method for studying peptides using Homology Modeling. This analytical technique provides valuable insights into peptide structure, purity, an...
Homology Modeling for Peptides
Understand homology modeling approaches for predicting peptide 3D structures from related template structures. This peptide or oligopeptide is studied for it...
Hours: Oligopeptide Research Reference
Injection. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...
HPLC FLD Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using HPLC FLD. This analytical technique provides valuable insights into peptide structure, purity, and ...
HPLC for Peptide Purification: Comprehensive Peptide Refe...
Guide to high-performance liquid chromatography techniques for isolating and purifying synthetic peptides. This peptide or oligopeptide is studied for its bi...
HPLC MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using HPLC MS. This analytical technique provides valuable insights into peptide structure, purity, and c...
HPLC UV Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using HPLC UV. This analytical technique provides valuable insights into peptide structure, purity, and c...
HPV L1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HPV L1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Hpv Peptides: Oligopeptide Research Reference
Peptides associated with Hpv including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ac...
HPV Vaccine L1: Oligopeptide Research Reference
HPV-vaccine-L1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological...
HRAS Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting HRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
hs-TnI: Oligopeptide Research Reference
Cardiac-specific troponin I (209 aa) measured by high-sensitivity assay. Released from damaged cardiomyocytes during myocardial injury. Normal: <0.04 ng/mL. ...
hs-TnT: Oligopeptide Research Reference
Cardiac-specific troponin T (298 aa) measured by high-sensitivity assay. Released from damaged cardiomyocytes. Normal: <14 ng/L. Acute MI: >14 ng/L with rise...
HSV GD Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HSV GD for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...
HTLV Tax Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting HTLV Tax for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
HTRF Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using HTRF. This analytical technique provides valuable insights into peptide structure, purity, and char...
Human Alpha-Defensin 1: Antimicrobial Peptide Reference
Neutrophil granule defensin with disulfide-stabilized structure for bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens...
Human Alpha-Defensin 2: Antimicrobial Peptide Reference
Neutrophil defensin with broad-spectrum bactericidal activity in phagolysosomal killing. This antimicrobial peptide demonstrates activity against pathogens a...
Human Alpha-Defensin 3: Antimicrobial Peptide Reference
Neutrophil defensin with strongest bactericidal activity and membrane disruption capability. This antimicrobial peptide demonstrates activity against pathoge...
Human Alpha-Defensin 4: Antimicrobial Peptide Reference
Neutrophil defensin with activity against intracellular pathogens including tuberculosis. This antimicrobial peptide demonstrates activity against pathogens ...
Human Alpha-Defensin 5: Antimicrobial Peptide Reference
Intestinal Paneth cell defensin maintaining gut microbiome homeostasis. This antimicrobial peptide demonstrates activity against pathogens and is studied for...
Human Alpha-Defensin 6: Antimicrobial Peptide Reference
Paneth cell defensin with synergistic antimicrobial activity with HD-5. This antimicrobial peptide demonstrates activity against pathogens and is studied for...
Human Beta-Defensin 1: Antimicrobial Peptide Reference
Constitutively expressed epithelial defensin providing innate defense at mucosal surfaces. This antimicrobial peptide demonstrates activity against pathogens...
Human Beta-Defensin 2: Antimicrobial Peptide Reference
Inducible epithelial antimicrobial peptide with potent activity against gram-negative bacteria and chemotactic properties for immune cells.
Human Beta-Defensin 2: Antimicrobial Peptide Reference
Inducible epithelial defensin upregulated by TLR activation during inflammation and infection. This antimicrobial peptide demonstrates activity against patho...
Human Beta-Defensin 3: Antimicrobial Peptide Reference
Most potent human defensin with broad-spectrum activity including MRSA and VRE, and strong immunomodulatory properties. Covers molecular mechanisms, biologic...
Human Beta-Defensin 3: Antimicrobial Peptide Reference
Potent inducible defensin with broad-spectrum activity and chemokine function recruiting immune cells. This peptide or oligopeptide is studied for its biolog...
Human Beta-Defensin 4: Antimicrobial Peptide Reference
Neutrophil-derived defensin with antimicrobial and wound healing functions at mucosal surfaces. This antimicrobial peptide demonstrates activity against path...
Human Cathelicidin hCAP18: Comprehensive Peptide Reference
Precursor protein of LL-37 with antimicrobial and immunomodulatory functions. This antimicrobial peptide demonstrates activity against pathogens and is studi...
Human Defensin 5: Antimicrobial Peptide Reference
human-defensin-5 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Human Defensin 6: Antimicrobial Peptide Reference
human-defensin-6 is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Huntington's Disease: Oligopeptide Research Reference
Huntington's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Huntingtons Peptides: Oligopeptide Research Reference
Peptides associated with Huntingtons including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Huwentoxin II: Peptide Toxin in Pharmacology Reference
huwentoxin-II is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...
Huwentoxin-I: Peptide Toxin in Pharmacology Reference
Huwentoxin-I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Huwentoxin-IV: Peptide Toxin in Pharmacology Reference
Huwentoxin-IV, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hyaluronan peptide: Structure, Function, and Significance
Hyaluronan-derived peptides have moisturizing and wound-healing properties. Low MW fragments stimulate hyaluronic acid synthesis.
Hydrocarbon Stapling System 1: Comprehensive Peptide Refe...
A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...
Hydrocarbon Stapling System 2: Comprehensive Peptide Refe...
A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...
Hydrocarbon Stapling System 3: Comprehensive Peptide Refe...
A hydrocarbon-stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key ...
Hydrocarbon Stapling: Oligopeptide Research Reference
Introduction of hydrocarbon cross-links to stabilize α-helical conformation. This peptide or oligopeptide is studied for its biological activity, structure-a...
Hydrogel encapsulation: Oligopeptide Research Reference
Comprehensive reference for hydrogel encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Hydrogel Formulation: Oligopeptide Research Reference
Hydrogel Formulation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hydrogel Peptide Delivery: Comprehensive Peptide Reference
Hydrogel matrices for sustained local peptide delivery and tissue engineering. This peptide or oligopeptide is studied for its biological activity, structure...
Hydrogel Self Assembly System 1
A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Hydrogel Self Assembly System 2
A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Hydrogel Self Assembly System 3
A hydrogel-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses ke...
Hydrogel System 1: Oligopeptide Research Reference
A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Hydrogel System 2: Oligopeptide Research Reference
A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Hydrogel System 3: Oligopeptide Research Reference
A hydrogel-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Hydrogen-Deuterium Exchange for Peptides
Explore HDX-MS techniques for mapping peptide dynamics, binding interfaces, and conformational changes. This peptide or oligopeptide is studied for its biolo...
Hydrolase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Hydrolase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-acti...
hydrophilicity Resource: Oligopeptide Research Reference
The hydrophilicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Hydrophobic Interaction Analysis
An analytical technique for characterizing peptides using Hydrophobic Interaction. This analytical technique provides valuable insights into peptide structur...
hydrophobic-core Resource: Comprehensive Peptide Reference
The hydrophobic-core database or resource for peptide research, providing data on structure, function, and interactions.
hydrophobicity Resource: Oligopeptide Research Reference
The hydrophobicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Hydroxylamine Cleavage Purification
A purification technique for separating and isolating peptides using Hydroxylamine Cleavage. This analytical technique provides valuable insights into peptid...
Hyenain 1: Oligopeptide Research Reference
hyenain-1 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Hyenain 2: Oligopeptide Research Reference
hyenain-2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Hymenoptaecin: Antimicrobial Peptide Reference
Giant AMP from honeybee with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...
Hyp3-bradykinin: Antimicrobial Peptide Reference
Hyp3-bradykinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hypa A: Oligopeptide Research Reference
Hypa A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hypertension Peptides: Oligopeptide Research Reference
Peptides associated with Hypertension including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Hypertension: Oligopeptide Research Reference
Sustained BP ≥130/80. Treatments: ACEi/ARBs, CCBs, diuretics, beta-blockers. This peptide or oligopeptide is studied for its biological activity, structure-a...
Hypocretin: Neuropeptide in Neuroscience Reference
Alternative name for orexin neuropeptides regulating sleep-wake transitions. This neuropeptide is involved in neurological signaling and is studied for its r...
Hypotensin (Polybia): Oligopeptide Research Reference
Hypotensin (Polybia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Hypothalamic releasing hormone
Hypothalamic releasing hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...
Iberiotoxin: Peptide Toxin in Pharmacology Reference
Highly selective BK potassium channel blocker from scorpion Buthus tamulus. This peptide toxin is derived from venom and studied for its pharmacological acti...
Ibotenic Acid: Oligopeptide Research Reference
Ibotenic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ICA for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using ICA. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...
Icatibant: Oligopeptide Research Reference
Bradykinin B2 receptor antagonist for hereditary angioedema acute attacks. This peptide or oligopeptide is studied for its biological activity, structure-act...
ICH Guidelines for Peptides: Comprehensive Peptide Reference
Explore International Council for Harmonisation guidelines applicable to peptide drug development and registration. Covers molecular mechanisms, biological a...
ICOS Agonist: Oligopeptide Research Reference
ICOS agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
id: Oligopeptide Research Reference
sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...
IdegLira Combination: Oligopeptide Research Reference
Single-pen fixed-ratio co-formulation of ultra-long-acting degludec with liraglutide simplifying therapy. This peptide or oligopeptide is studied for its bio...
Identity Testing: Oligopeptide Research Reference
Identity Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Idursulfase: Oligopeptide Research Reference
Idursulfase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
IE HPLC Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using IE HPLC. This analytical technique provides valuable insights into peptide structure, pu...
IEF Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using IEF. This analytical technique provides valuable insights into peptide structure, purity, and chara...
IEX (Ion Exchange Chromatography)
Comprehensive reference for IEX (Ion Exchange Chromatography), a peptide compound with applications in research and therapeutics.
IEX Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using IEX. This analytical technique provides valuable insights into peptide structure, purity...
IFN Alpha Hormone: Endogenous Peptide Hormone Reference
IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Alpha Peptide Hormone: Comprehensive Peptide Reference
IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Alpha Protein Hormone: Comprehensive Peptide Reference
IFN Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Beta Hormone: Endogenous Peptide Hormone Reference
IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
IFN Beta Peptide Hormone: Endogenous Peptide Hormone Refe...
IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
IFN Beta Protein Hormone: Endogenous Peptide Hormone Refe...
IFN Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
IFN Gamma Hormone: Endogenous Peptide Hormone Reference
IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Gamma Peptide Hormone: Comprehensive Peptide Reference
IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Gamma Protein Hormone: Comprehensive Peptide Reference
IFN Gamma, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
IFN Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IFN Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
IGF 1 Analog: Oligopeptide Research Reference
IGF 1 analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
IGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
IGF1R Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IGF1R Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
IL 1 Hormone: Endogenous Peptide Hormone Reference
IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 1 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IL 1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
IL 1 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 1 Protein Hormone: Endogenous Peptide Hormone Reference
IL 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 10 Agonist: Oligopeptide Research Reference
IL 10 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
IL 10 Hormone: Endogenous Peptide Hormone Reference
IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 10 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 10 Protein Hormone: Endogenous Peptide Hormone Reference
IL 10, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 11 Hormone: Endogenous Peptide Hormone Reference
IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 11 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 11 Protein Hormone: Endogenous Peptide Hormone Reference
IL 11, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 12 Hormone: Endogenous Peptide Hormone Reference
IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 12 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 12 Protein Hormone: Endogenous Peptide Hormone Reference
IL 12, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 13 Hormone: Endogenous Peptide Hormone Reference
IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 13 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 13 Protein Hormone: Endogenous Peptide Hormone Reference
IL 13, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 15 Hormone: Endogenous Peptide Hormone Reference
IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 15 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 15 Protein Hormone: Endogenous Peptide Hormone Reference
IL 15, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 17 Antibody: Oligopeptide Research Reference
IL 17 antibody in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
IL 17 Hormone: Endogenous Peptide Hormone Reference
IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 17 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IL 17 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
IL 17 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 17 Protein Hormone: Endogenous Peptide Hormone Reference
IL 17, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 18 Hormone: Endogenous Peptide Hormone Reference
IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 18 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 18 Protein Hormone: Endogenous Peptide Hormone Reference
IL 18, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 1ra: Oligopeptide Research Reference
IL 1ra in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
IL 2 Hormone: Endogenous Peptide Hormone Reference
IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 2 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 2 Protein Hormone: Endogenous Peptide Hormone Reference
IL 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 23 Antibody: Oligopeptide Research Reference
IL 23 antibody in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
IL 23 Hormone: Endogenous Peptide Hormone Reference
IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 23 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 23 Protein Hormone: Endogenous Peptide Hormone Reference
IL 23, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 3 Hormone: Endogenous Peptide Hormone Reference
IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 3 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 3 Protein Hormone: Endogenous Peptide Hormone Reference
IL 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 33 Hormone: Endogenous Peptide Hormone Reference
IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 33 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 33 Protein Hormone: Endogenous Peptide Hormone Reference
IL 33, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
IL 4 Agonist: Oligopeptide Research Reference
IL 4 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
IL 4 Hormone: Endogenous Peptide Hormone Reference
IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 4 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 4 Protein Hormone: Endogenous Peptide Hormone Reference
IL 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 5 Hormone: Endogenous Peptide Hormone Reference
IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 5 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 5 Protein Hormone: Endogenous Peptide Hormone Reference
IL 5, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 6 Hormone: Endogenous Peptide Hormone Reference
IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 6 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting IL 6 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
IL 6 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 6 Protein Hormone: Endogenous Peptide Hormone Reference
IL 6, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 6 Receptor Antagonist: Oligopeptide Research Reference
IL 6 receptor antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
IL 7 Hormone: Endogenous Peptide Hormone Reference
IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 7 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 7 Protein Hormone: Endogenous Peptide Hormone Reference
IL 7, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 8 Hormone: Endogenous Peptide Hormone Reference
IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 8 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 8 Protein Hormone: Endogenous Peptide Hormone Reference
IL 8, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 9 Hormone: Endogenous Peptide Hormone Reference
IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 9 Peptide Hormone: Endogenous Peptide Hormone Reference
IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL 9 Protein Hormone: Endogenous Peptide Hormone Reference
IL 9, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
IL-1beta (Interleukin-1 Beta): Comprehensive Peptide Refe...
Comprehensive reference for IL-1beta (Interleukin-1 Beta), a peptide compound with applications in research and therapeutics.
IL-6 (Interleukin-6): Oligopeptide Research Reference
IL-6 (Interleukin-6), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
IL-8 (Interleukin-8 / CXCL8): Comprehensive Peptide Refer...
Comprehensive reference for IL-8 (Interleukin-8 / CXCL8), a peptide compound with applications in research and therapeutics.
Imaging Agents: Oligopeptide Research Reference
Peptide-based imaging agents for diagnostics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
imaging for Peptides: Analytical Technique in Peptide Res...
Application of imaging technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...
Imaging Mass Spec Analysis: Comprehensive Peptide Reference
An analytical technique for characterizing peptides using Imaging Mass Spec. This analytical technique provides valuable insights into peptide structure, pur...
IMCY-0098: Oligopeptide Research Reference
IMCY-0098, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Imipenem/Relebactam: Oligopeptide Research Reference
Imipenem/Relebactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Immunoaffinity Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Immunoaffinity. This analytical technique provides valuable insights into peptide structure, purity...
Immunoaffinity Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Immunoaffinity. This analytical technique provides valuable insights into peptide struct...
Immunogenicity: Oligopeptide Research Reference
ADA formation reducing efficacy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Immunology / T Cell Biology: Comprehensive Peptide Reference
Immunology / T Cell Biology is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...
Immunomodulatory / Checkpoint Modulator
Immunomodulatory / Checkpoint Modulator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...
Immunosuppressant Interactions
Drug interactions between immunosuppressant peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Impatiens: Oligopeptide Research Reference
Impatiens, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Implantable Delivery: Oligopeptide Research Reference
Implantable devices for sustained peptide drug release. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Implantable Peptide Delivery: Comprehensive Peptide Refer...
Understand biodegradable implant devices for long-term controlled release of peptide therapeutics. This peptide or oligopeptide is studied for its biological...
Implantable: Oligopeptide Research Reference
Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...
Impurity Profiling for Peptides
Learn strategies for identifying, characterizing, and controlling impurities in peptide drug substances and products. Covers molecular mechanisms, biological...
incidence Resource: Oligopeptide Research Reference
The incidence database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Indolicidin: Oligopeptide Research Reference
Indolicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Industrial: Oligopeptide Research Reference
Industrial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activit...
Infectious Disease / COVID-19 (Protein Subunit)
Infectious Disease / COVID-19 (Protein Subunit) is a bioactive compound with applications in peptide research and therapeutics.
Infectious Disease / EBV-Associated Cancer
Infectious Disease / EBV-Associated Cancer is a bioactive compound with applications in peptide research and therapeutics.
Infectious Disease: Oligopeptide Research Reference
Diseases caused by pathogenic microorganisms (bacteria, viruses, fungi, parasites). Treatments: antibiotics (bacterial), antivirals (viral), antifungals (fun...
Infectious Diseases and Peptides
Discover antimicrobial and antiviral peptide therapeutics for combating infectious diseases and drug-resistant pathogens.
Infectious: Oligopeptide Research Reference
Antimicrobial peptides, viral peptides, diagnostic markers. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...
Inflammatory: Oligopeptide Research Reference
Infection, sepsis, autoimmune disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Influenza HA Stem Vaccine: Comprehensive Peptide Reference
A peptide vaccine targeting Influenza HA Stem for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structu...
Influenza HA Stem: Oligopeptide Research Reference
influenza-HA-stem is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologi...
Influenza M2e Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Influenza M2e for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...
Influenza M2e: Oligopeptide Research Reference
influenza-M2e is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...
Influenza Peptides: Oligopeptide Research Reference
Peptides associated with Influenza including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...
Influenza: Oligopeptide Research Reference
Influenza A/B virus. Treatments: oseltamivir, baloxavir. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Inhaled Insulin Lispro: Oligopeptide Research Reference
Inhaled insulin lispro formulation for pulmonary delivery using specialized dry powder inhaler. This peptide or oligopeptide is studied for its biological ac...
Inhaled Insulin Technosphere: Comprehensive Peptide Refer...
Pulmonary insulin delivery using fumaryl diketopiperamine microparticles for rapid-onset prandial glucose control. Covers molecular mechanisms, biological ac...
Inhibin A: Oligopeptide Research Reference
inhibin A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Inhibin Alpha: Endogenous Peptide Hormone Reference
inhibin-alpha is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Inhibin and Activin Family Peptides
Guide to inhibin and activin peptides in TGF-beta signaling and reproductive biology. This peptide or oligopeptide is studied for its biological activity, st...
Inhibin Beta A: Endogenous Peptide Hormone Reference
inhibin-beta-A is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Inhibin Beta B: Endogenous Peptide Hormone Reference
inhibin-beta-B is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
Inhibition: Oligopeptide Research Reference
Suppression of target activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Inhibits protein synthesis, glutathione depletion
Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
Injectable Hydrogel Depot: Comprehensive Peptide Reference
Injectable hydrogels forming sustained-release depots for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Injection Site Reactions: Oligopeptide Research Reference
Local adverse reactions at peptide drug injection sites. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Inkjet Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Inkjet for producing peptides with specific properties. This analytical technique provides valuable insights into peptide st...
inkjet-printing for Peptides: Comprehensive Peptide Refer...
Application of inkjet-printing technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological activ...
INS-1 (C. elegans): Oligopeptide Research Reference
INS-1 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-10 (C. elegans): Oligopeptide Research Reference
INS-10 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-2 (C. elegans): Oligopeptide Research Reference
INS-2 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-3 (C. elegans): Oligopeptide Research Reference
INS-3 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-4 (C. elegans): Oligopeptide Research Reference
INS-4 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-5 (C. elegans): Oligopeptide Research Reference
INS-5 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-6 (C. elegans): Oligopeptide Research Reference
INS-6 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-7 (C. elegans): Oligopeptide Research Reference
INS-7 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-8 (C. elegans): Oligopeptide Research Reference
INS-8 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
INS-9 (C. elegans): Oligopeptide Research Reference
INS-9 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Insect AMP Immune Induction: Comprehensive Peptide Reference
Pathogen recognition and signaling for AMP gene expression in insects. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...
Insect Antimicrobial / Alpha-helical
Insect Antimicrobial / Alpha-helical is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...
Insect Antimicrobial / Glycine-rich
Insect Antimicrobial / Glycine-rich is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Insect Defensin / Antimicrobial
Insect Defensin / Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Insect Defensins: Oligopeptide Research Reference
Antimicrobial (Gram-positive). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Insect Hormone / Cardiovascular
Insect Hormone / Cardiovascular is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Insect Hormone / Development: Comprehensive Peptide Refer...
Insect Hormone / Development is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...
Insect Hormone / Reproduction: Comprehensive Peptide Refe...
Insect Hormone / Reproduction is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Insect Hormones: Oligopeptide Research Reference
Development, metabolism, homeostasis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Insomnia Peptides: Oligopeptide Research Reference
Peptides associated with Insomnia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Insulin (Human): Oligopeptide Research Reference
Natural human insulin produced by recombinant DNA technology. 51-aa heterodimer. This peptide or oligopeptide is studied for its biological activity, structu...
Insulin → Insulin Receptor (RTK Activation)
Comprehensive reference for Insulin → Insulin Receptor (RTK Activation), a peptide compound with applications in research and therapeutics.
Insulin → Insulin Receptor: Comprehensive Peptide Reference
Comprehensive reference for Insulin → Insulin Receptor, a peptide compound with applications in research and therapeutics.
Insulin 327: Oligopeptide Research Reference
Novel long-acting insulin analog with albumin binding and receptor activation properties for once-weekly dosing. Covers molecular mechanisms, biological acti...
Insulin 70/30: Oligopeptide Research Reference
Premixed insulin combining 70% NPH and 30% regular insulin for basal-bolus coverage. This peptide or oligopeptide is studied for its biological activity, str...
Insulin A-chain ↔ B-chain (Disulfide Bonds)
Comprehensive reference for Insulin A-chain ↔ B-chain (Disulfide Bonds), a peptide compound with applications in research and therapeutics.
Insulin A-Chain Mutants: Peptide Family Reference
Engineered insulin A-chain variants with altered receptor binding affinity used in structure-activity studies. This peptide or oligopeptide is studied for it...
Insulin A-chain-1-10: Oligopeptide Research Reference
Comprehensive reference for insulin A-chain-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin A-chain-1-15: Oligopeptide Research Reference
Comprehensive reference for insulin A-chain-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin A-chain-1-20: Oligopeptide Research Reference
Comprehensive reference for insulin A-chain-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin A-chain-1-21: Oligopeptide Research Reference
Comprehensive reference for insulin A-chain-1-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin A-chain-8-21: Oligopeptide Research Reference
Comprehensive reference for insulin A-chain-8-21 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin A-Chain: Structure, Disulfide Architecture, and C...
An overview of the insulin A-chain, a 21-residue peptide that forms one-half of the bioactive insulin heterodimer critical for glucose homeostasis.
Insulin Allergy Management: Comprehensive Peptide Reference
Diagnosis and treatment of insulin hypersensitivity including desensitization and formulation switching. This peptide or oligopeptide is studied for its biol...
Insulin Analogue Immunogenicity
Risk of anti-drug antibody formation against insulin analogues and clinical implications. This peptide or oligopeptide is studied for its biological activity...
Insulin Analogues: Endogenous Peptide Hormone Reference
Pharmacological properties and clinical applications of rapid-acting (lispro, aspart) and long-acting (glargine, degludec) insulin analogues for diabetes man...
Insulin Antibody Syndrome: Comprehensive Peptide Reference
Rare condition of high-affinity insulin autoantibodies causing unpredictable glycemic excursions. This peptide or oligopeptide is studied for its biological ...
Insulin Aspart Protamine: Oligopeptide Research Reference
Rapid-acting insulin aspart complexed with protamine. Intermediate-acting profile. This peptide or oligopeptide is studied for its biological activity, struc...
Insulin Aspart: Oligopeptide Research Reference
insulin aspart in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Insulin Aspart: Oligopeptide Research Reference
Rapid-acting insulin analog. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
Insulin Assay Cross-Reactivity
Analytical challenges with insulin immunoassay cross-reactivity from analogs, proinsulin, and antibody complexes. Covers molecular mechanisms, biological act...
Insulin B-Chain Mutants: Peptide Family Reference
Engineered insulin B-chain variants used to study self-association, receptor binding, and pharmacokinetic optimization. Covers molecular mechanisms, biologic...
Insulin B-chain-1-10: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-1-15: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-1-15 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-1-20: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-1-25: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-1-30: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-13-30: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-13-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-20-30: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-20-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-23-30: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-23-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-chain-8-30: Oligopeptide Research Reference
Comprehensive reference for insulin B-chain-8-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Insulin B-Chain: Oligopeptide Research Reference
The 30-amino acid B-chain of insulin forms the structural core of the insulin heterodimer, essential for receptor binding and glucose homeostasis.
Insulin Biosimilars: Peptide Family Reference
Follow-on biologic insulin products demonstrating comparable safety, purity, and efficacy to reference insulin products.
Insulin C-Peptide: Oligopeptide Research Reference
31-aa peptide from proinsulin. Biomarker for endogenous insulin production. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Insulin Cardiovascular Outcomes
Cardiovascular safety and outcomes data for insulin analogues from large randomized controlled trials. This peptide or oligopeptide is studied for its biolog...
Insulin COI-316: Oligopeptide Research Reference
Ultra-long-acting insulin analog with high albumin affinity and slow receptor dissociation for weekly dosing. This peptide or oligopeptide is studied for its...
Insulin Cold Chain Management: Comprehensive Peptide Refe...
Requirements and best practices for maintaining insulin cold chain integrity from manufacturing to patient use. Covers molecular mechanisms, biological activ...
Insulin Degludec Aspart Combination
Dual insulin formulation combining degludec and aspart in fixed ratio for diabetes. This peptide or oligopeptide is studied for its biological activity, stru...
Insulin Degludec Multi-Hexamer Chains
Self-assembly of insulin degludec into soluble multi-hexamer chains in subcutaneous tissue for ultra-long basal release.
Insulin Degludec: Oligopeptide Research Reference
insulin degludec in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Insulin Degludec: Oligopeptide Research Reference
Ultra-long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Insulin Degludec/Aspart 70:30: Comprehensive Peptide Refe...
Co-formulation of ultra-long-acting insulin degludec and rapid-acting insulin aspart for basal-bolus coverage. This peptide or oligopeptide is studied for it...
Insulin Degludec/Aspart: Therapeutic Peptide Drug Profile
Premixed insulin with 70% insulin degludec (long-acting) and 30% insulin aspart (rapid-acting). Provides both basal and prandial coverage. Indication: Type 2...
Insulin Degludec/Liraglutide: Comprehensive Peptide Refer...
Fixed-ratio degludec/liraglutide. Basal insulin plus GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Insulin Detemir: Oligopeptide Research Reference
insulin detemir in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Insulin Detemir: Oligopeptide Research Reference
Long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
Insulin Efsitora Alfa: Oligopeptide Research Reference
Weekly basal insulin Fc fusion protein combining insulin efsitora with human IgG2 Fc for extended half-life. This peptide or oligopeptide is studied for its ...
Insulin Family Peptides: Oligopeptide Research Reference
Explore the insulin family of peptides including insulin, IGF-1, IGF-2, and relaxin, key regulators of metabolism and growth.
Insulin Fc Fusion: Oligopeptide Research Reference
Genetically engineered insulin-Fc fusion protein utilizing neonatal Fc receptor recycling for weekly basal dosing. Covers molecular mechanisms, biological ac...
Insulin Glargine 300: Oligopeptide Research Reference
Concentrated formulation of insulin glargine providing more stable pharmacokinetic profile with less nocturnal hypoglycemia.
Insulin Glargine Biosimilar: Comprehensive Peptide Reference
Biosimilar interchangeable form of insulin glargine with identical amino acid sequence and equivalent pharmacokinetic profile.
Insulin Glargine Metabolites: Comprehensive Peptide Refer...
Active metabolites M1 and M2 contributing to prolonged glucose-lowering activity of insulin glargine. This peptide or oligopeptide is studied for its biologi...
Insulin Glargine Phosphate Buffer System
Acidic phosphate buffer system enabling glargine solution for injection before pH-dependent precipitation. This peptide or oligopeptide is studied for its bi...
Insulin Glargine U300: Therapeutic Peptide Drug Profile
Concentrated insulin glargine (300 units/mL). Slower absorption from larger subcutaneous depot. T½ ~36 hours. Flatter profile than U-100. Indication: Type 1 ...
Insulin Glargine U500: Therapeutic Peptide Drug Profile
Highly concentrated insulin glargine (500 units/mL). 5× concentration reduces injection volume. Mimics NPH-like profile due to slower absorption. Indication:...
Insulin Glargine: Oligopeptide Research Reference
insulin glargine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Insulin Glargine: Oligopeptide Research Reference
Long-acting basal insulin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
Insulin Glargine/Lixisenatide Fixed Ratio
Fixed-ratio combination of basal insulin glargine and rapid-acting GLP-1 agonist lixisenatide. This peptide or oligopeptide is studied for its biological act...
Insulin Glargine/Lixisenatide: Comprehensive Peptide Refe...
Fixed-ratio glargine/lixisenatide. Basal insulin plus prandial GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, structure-...
Insulin Glulisine: Peptide Family Reference
Rapid-acting insulin analog with asparagine at B3 replaced by lysine and lysine at B29 replaced by glutamic acid for rapid absorption.
Insulin Hepatic First-Pass: Comprehensive Peptide Reference
First-pass hepatic extraction of portal insulin and implications for peripheral versus portal delivery. This peptide or oligopeptide is studied for its biolo...
Insulin Hormone: Endogenous Peptide Hormone Reference
Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Insulin Icodec: Peptide Family Reference
Once-weekly basal insulin analog with ultra-long half-life exceeding 196 hours, representing the first weekly insulin formulation.
Insulin in Pregnancy: Oligopeptide Research Reference
Safety considerations for insulin analog use in gestational and pregestational diabetes during pregnancy. This peptide or oligopeptide is studied for its bio...
Insulin Injection Site Lipohypertrophy
Lipodystrophy at insulin injection sites caused by localized anabolic effects leading to erratic absorption. This peptide or oligopeptide is studied for its ...
Insulin Injection Sites: Oligopeptide Research Reference
Anatomical considerations for subcutaneous injection including absorption rates from abdomen, thigh, arm, and buttock. Covers molecular mechanisms, biologica...
Insulin Like Growth Factor 1-10
Comprehensive reference for insulin like growth factor 1-10, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 1-20
Comprehensive reference for insulin like growth factor 1-20, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 1-30
Comprehensive reference for insulin like growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 1-40
Comprehensive reference for insulin like growth factor 1-40, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 1-60
Comprehensive reference for insulin like growth factor 1-60, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 1-70
Comprehensive reference for insulin like growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 30-70
Comprehensive reference for insulin like growth factor 30-70, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 40-70
Comprehensive reference for insulin like growth factor 40-70, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 50-70
Comprehensive reference for insulin like growth factor 50-70, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor 60-70
Comprehensive reference for insulin like growth factor 60-70, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor des-1-10
Comprehensive reference for insulin like growth factor des-1-10, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor des-1-3
Comprehensive reference for insulin like growth factor des-1-3, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Like Growth Factor des-1-6
Comprehensive reference for insulin like growth factor des-1-6, covering molecular structure, pharmacological properties, receptor interactions,
Insulin Lipohypertrophy: Oligopeptide Research Reference
Pathophysiology and prevention of subcutaneous lipohypertrophy from repetitive injection at same sites. This peptide or oligopeptide is studied for its biolo...
Insulin Lispro AABC: Oligopeptide Research Reference
Concentrated insulin lispro (U-200). Larger doses in smaller volumes. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Insulin Lispro Mix 50/50: Oligopeptide Research Reference
Premixed insulin containing 50% lispro protamine and 50% insulin lispro for balanced prandial and basal coverage. Covers molecular mechanisms, biological act...
Insulin Lispro Mix 75/25: Oligopeptide Research Reference
Premixed formulation with 75% lispro protamine intermediate-acting and 25% insulin lispro rapid-acting. This peptide or oligopeptide is studied for its biolo...
Insulin Lispro: Oligopeptide Research Reference
insulin lispro in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Insulin Lispro: Oligopeptide Research Reference
Rapid-acting insulin analog. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
Insulin Nanoparticle Encapsulation
Biodegradable nanoparticle encapsulation of insulin for oral bioavailability protection in GI tract. This peptide or oligopeptide is studied for its biologic...
Insulin NPH: Oligopeptide Research Reference
Intermediate-acting insulin with protamine suspension, providing 12-18 hours of basal coverage for twice-daily dosing. Covers molecular mechanisms, biologica...
Insulin Overdose: Oligopeptide Research Reference
Excessive insulin dosing. Can cause severe hypoglycemia, seizures, coma, and death. This peptide or oligopeptide is studied for its biological activity, stru...
Insulin PDegludec: Oligopeptide Research Reference
insulin-pDegludec is a modified insulin analog with altered pharmacokinetic properties for improved diabetes management.
Insulin PEGylation Technology: Comprehensive Peptide Refe...
PEG conjugation to insulin analogs for extending half-life through reduced renal clearance and proteolysis. This peptide or oligopeptide is studied for its b...
Insulin Pen Devices: Oligopeptide Research Reference
Mechanical and electronic insulin pen devices including dose memory and bluetooth connectivity. This peptide or oligopeptide is studied for its biological ac...
Insulin Peptide Hormone: Endogenous Peptide Hormone Refer...
Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Insulin Phylogenetic Evolution
Evolutionary history of insulin from ancestral peptides in invertebrates through modern mammalian insulins. This peptide or oligopeptide is studied for its b...
Insulin Premixed: Oligopeptide Research Reference
Combination of intermediate and rapid-acting insulin providing both basal and prandial coverage in a single injection. Covers molecular mechanisms, biologica...
Insulin Protein Hormone: Endogenous Peptide Hormone Refer...
Insulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Insulin Pump Diluent: Oligopeptide Research Reference
Sterile diluent solution for diluting concentrated insulin formulations for pump reservoir compatibility. This peptide or oligopeptide is studied for its bio...
Insulin Pump Infusion Sets: Comprehensive Peptide Reference
Subcutaneous catheter systems for continuous insulin delivery from external pump devices. This peptide or oligopeptide is studied for its biological activity...
Insulin Pump Therapy: Oligopeptide Research Reference
Continuous subcutaneous insulin infusion using rapid-acting analogs for precise basal-bolus insulin delivery. This peptide or oligopeptide is studied for its...
Insulin Receptor Binding Kinetics
Quantitative analysis of insulin-receptor interaction including binding affinity and dissociation rates. This peptide or oligopeptide is studied for its biol...
Insulin Regular: Oligopeptide Research Reference
Short-acting crystalline zinc insulin for intravenous and subcutaneous use with peak effect at 2-4 hours. This peptide or oligopeptide is studied for its bio...
Insulin Renal Clearance: Oligopeptide Research Reference
Kidney-mediated insulin degradation and dosing adjustments in chronic and end-stage kidney disease. This peptide or oligopeptide is studied for its biologica...
Insulin Smart Pump Systems: Comprehensive Peptide Reference
Closed-loop pump systems with continuous glucose monitoring for automated basal insulin delivery. This peptide or oligopeptide is studied for its biological ...
Insulin Storage Stability: Comprehensive Peptide Reference
Guidelines for insulin storage including refrigeration at 2-8 degrees Celsius and in-use room temperature stability. Covers molecular mechanisms, biological ...
Insulin Subcutaneous Pharmacokinetics
Factors affecting subcutaneous absorption including blood flow, capillary permeability, and concentration. This peptide or oligopeptide is studied for its bi...
Insulin Therapy and Weight Gain
Mechanisms and clinical management of weight gain associated with insulin therapy. This peptide or oligopeptide is studied for its biological activity, struc...
Insulin Titration Algorithms: Comprehensive Peptide Refer...
Algorithmic approaches to basal insulin dose titration including treat-to-target protocols. This peptide or oligopeptide is studied for its biological activi...
Insulin Transdermal Delivery: Comprehensive Peptide Refer...
Microneedle and iontophoresis technologies enabling transdermal insulin delivery across stratum corneum. This peptide or oligopeptide is studied for its biol...
Insulin U-100 Concentration Standard
Standard 100 units/mL insulin concentration used as the reference formulation for all dose calculations. This peptide or oligopeptide is studied for its biol...
Insulin-Related Hypoglycemia Unawareness
Condition of impaired awareness of hypoglycemia developing from recurrent insulin-induced hypoglycemic episodes. Covers molecular mechanisms, biological acti...
Insulin: Oligopeptide Research Reference
A 51-amino acid peptide hormone produced by pancreatic β-cells that regulates glucose metabolism, with A-chain (21 aa) and B-chain (30 aa) connected by disul...
Integrin Pathway Peptide 1: Comprehensive Peptide Reference
A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Integrin Pathway Peptide 2: Comprehensive Peptide Reference
A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Integrin Pathway Peptide 3: Comprehensive Peptide Reference
A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Integrin Pathway Peptide 4: Comprehensive Peptide Reference
A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Integrin Pathway Peptide 5: Comprehensive Peptide Reference
A peptide involved in the Integrin signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
interface-area Resource: Oligopeptide Research Reference
The interface-area database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Interferon Alfa: Oligopeptide Research Reference
Type I interferon glycoprotein with antiviral, antiproliferative, and immunomodulatory effects for hepatitis and cancer.
Interferon Beta: Oligopeptide Research Reference
Type I interferon for multiple sclerosis that reduces relapse rate through immunomodulatory and anti-inflammatory mechanisms.
Interferon Gamma: Oligopeptide Research Reference
Type II interferon that activates macrophages and enhances immune function for chronic granulomatous disease and osteopetrosis.
Interferon IFN-alpha-1: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-1, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-10: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-10, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-14: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-14, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-16: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-16, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-17: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-17, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-4: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-4, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-5: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-5, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-6: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-6, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-7: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-7, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-alpha-8: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-alpha-8, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-beta-1a: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-beta-1a, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-beta-1b: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-beta-1b, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-beta-3: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-beta-3, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-delta: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-delta, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-epsilon-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-epsilon-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-epsilon: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-epsilon, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-gamma: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-gamma, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-kappa-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-kappa-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-kappa: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-kappa, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-lambda-1: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-lambda-1, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-lambda-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-lambda-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-lambda-3: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-lambda-3, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-lambda-4: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-lambda-4, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-mu-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-mu-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-mu: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-mu, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-nu-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-nu-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-nu: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-nu, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-omega: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-omega, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-tau: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-tau, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-theta-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-theta-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-theta: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-theta, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-xi-2: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-xi-2, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-xi: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-xi, covering molecular structure, pharmacological properties, receptor interactions,
Interferon IFN-zeta: Oligopeptide Research Reference
Comprehensive reference for interferon IFN-zeta, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-10: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-10, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-11: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-11, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-12: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-12, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-13: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-13, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-15: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-15, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-16: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-16, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17A: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17A, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17B: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17B, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17C: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17C, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17D: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17D, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17E: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17E, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-17F: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-17F, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-18: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-18, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-19: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-19, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-1alpha: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-1alpha, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-1beta: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-1beta, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-2: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-2, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-20: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-20, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-21: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-21, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-22: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-22, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-23: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-23, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-24: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-24, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-25: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-25, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-26: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-26, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-27: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-27, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-28A: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-28A, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-28B: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-28B, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-29: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-29, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-3: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-3, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-30: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-30, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-31: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-31, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-32: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-32, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-33: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-33, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-34: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-34, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-35: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-35, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-36alpha: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-36alpha, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-36beta: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-36beta, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-36gamma: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-36gamma, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-37: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-37, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-38: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-38, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-39: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-39, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-4: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-4, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-40: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-40, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-5: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-5, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-6: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-6, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-7: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-7, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-8: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-8, covering molecular structure, pharmacological properties, receptor interactions,
Interleukin IL-9: Oligopeptide Research Reference
Comprehensive reference for interleukin IL-9, covering molecular structure, pharmacological properties, receptor interactions,
Intermedin: Neuropeptide in Neuroscience Reference
intermedin is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This neuropeptide is involved in neurological signaling ...
International Peptide Society: Comprehensive Peptide Refe...
Professional society for peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
InterPro Resource: Oligopeptide Research Reference
The InterPro database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Intracellular targeting, mitochondrial disruption
Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Intranasal Peptide Delivery: Comprehensive Peptide Reference
Nasal delivery systems for peptide drugs targeting CNS or systemic absorption. This peptide or oligopeptide is studied for its biological activity, structure...
Intrathecal Peptide Delivery: Comprehensive Peptide Refer...
Explore intrathecal injection methods for delivering peptides directly into the cerebrospinal fluid. This peptide or oligopeptide is studied for its biologic...
Intravenous Peptide Delivery: Comprehensive Peptide Refer...
Learn about intravenous administration of peptide therapeutics for rapid systemic delivery and controlled dosing. Covers molecular mechanisms, biological act...
Intrinsically Disordered System 1
A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
Intrinsically Disordered System 2
A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
Intrinsically Disordered System 3
A intrinsically-disordered-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
IO102/IO103: Oligopeptide Research Reference
IO102/IO103, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Iodoacetamide Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Iodoacetamide. This analytical technique provides valuable insights into peptide structu...
Iodoacetyl Purification: Analytical Technique in Peptide ...
A purification technique for separating and isolating peptides using Iodoacetyl. This analytical technique provides valuable insights into peptide structure,...
Ion channel: Oligopeptide Research Reference
Comprehensive reference for ion channel, covering molecular structure, pharmacological properties, receptor interactions,
Ion Exchange Analysis: Analytical Technique in Peptide Re...
An analytical technique for characterizing peptides using Ion Exchange. This analytical technique provides valuable insights into peptide structure, purity, ...
Ion Mobility Spectrometry for Peptides
Discover ion mobility spectrometry for separating peptide conformers and measuring collision cross sections. This peptide or oligopeptide is studied for its ...
Ion Transport Peptide: Oligopeptide Research Reference
Ion Transport Peptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ionization-potential Resource: Comprehensive Peptide Refe...
The ionization-potential database or resource for peptide research, providing data on structure, function, and interactions.
Iontophoresis Peptide Delivery
Understand iontophoretic enhancement for transdermal peptide delivery using low-level electrical current. This peptide or oligopeptide is studied for its bio...
Ipilimumab: Oligopeptide Research Reference
ipilimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
IPP: Oligopeptide Research Reference
Isoleucine-proline-proline. ACE-inhibitory tripeptide from casein. Found in fermented milk. This peptide or oligopeptide is studied for its biological activi...
Irisin 1-100: Peptide Fragment Reference
Comprehensive reference for irisin 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin 1-112: Peptide Fragment Reference
Comprehensive reference for irisin 1-112 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin 1-20: Peptide Fragment Reference
Comprehensive reference for irisin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin 1-40: Peptide Fragment Reference
Comprehensive reference for irisin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin 1-60: Peptide Fragment Reference
Comprehensive reference for irisin 1-60 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin 1-80: Peptide Fragment Reference
Comprehensive reference for irisin 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin FNIPQPNFW: Endogenous Peptide Hormone Reference
Comprehensive reference for irisin FNIPQPNFW variant, covering molecular structure, pharmacological properties, receptor interactions,
Irisin Hormone: Endogenous Peptide Hormone Reference
Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Irisin Peptide Hormone: Endogenous Peptide Hormone Reference
Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Irisin Protein Hormone: Endogenous Peptide Hormone Reference
Irisin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Irisin: Structure, Function, and Significance
Irisin is a myokine released during exercise that promotes browning of white adipose tissue and increases energy expenditure.
ISA101: Oligopeptide Research Reference
ISA101, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Isoelectric Focusing Analysis: Comprehensive Peptide Refe...
An analytical technique for characterizing peptides using Isoelectric Focusing. This analytical technique provides valuable insights into peptide structure, ...
Isoelectric Precipitation Purification
A purification technique for separating and isolating peptides using Isoelectric Precipitation. This analytical technique provides valuable insights into pep...
Isoleucine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Isoleucine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...
Isoleucine Modification: Post-Translational Modification ...
Post-translational modifications of Isoleucine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...
Isoleucine Peptide: Oligopeptide Research Reference
Isoleucine (I) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...
Isomerase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Isomerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Isopeptide Bonds in Peptides: Comprehensive Peptide Refer...
Learn about non-canonical isopeptide bonds in peptide cross-linking and stability. This modification affects peptide stability, receptor binding, and biologi...
Isostere System 1: Oligopeptide Research Reference
A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Isostere System 2: Oligopeptide Research Reference
A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Isostere System 3: Oligopeptide Research Reference
A isostere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Isothermal Titration Calorimetry
ITC for measuring peptide-protein binding thermodynamics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...
isothermal-titration for Peptides
Application of isothermal-titration technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological ...
ITC Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using ITC. This analytical technique provides valuable insights into peptide structure, purity, and chara...
ITC for Peptide Thermodynamics
Discover isothermal titration calorimetry for measuring thermodynamic parameters of peptide-ligand interactions. Covers molecular mechanisms, biological acti...
ITC: Oligopeptide Research Reference
mg. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...
Itovebi: Oligopeptide Research Reference
Itovebi, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
IUPHAR/BPS Guide to Pharmacology
Comprehensive guide to pharmacological targets and their ligands. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Ixazomib Oral Proteasome Inhibitor
First oral boronic acid proteasome inhibitor for multiple myeloma, enabling convenient oral chemotherapy regimens. Covers molecular mechanisms, biological ac...
Ixazomib: Oligopeptide Research Reference
First oral proteasome inhibitor for multiple myeloma, a boronic acid that reversibly inhibits the 20S proteasome beta5 subunit.
JAK Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting JAK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
JAK STAT Modulator: Oligopeptide Research Reference
JAK STAT modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
JAK-STAT Pathway Peptide 1: Comprehensive Peptide Reference
A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
JAK-STAT Pathway Peptide 2: Comprehensive Peptide Reference
A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
JAK-STAT Pathway Peptide 3: Comprehensive Peptide Reference
A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
JAK-STAT Pathway Peptide 4: Comprehensive Peptide Reference
A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
JAK-STAT Pathway Peptide 5: Comprehensive Peptide Reference
A peptide involved in the JAK-STAT signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Japonicin 2: Antimicrobial Peptide Reference
japonicin-2 is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
JASCO J-1500: Oligopeptide Research Reference
Circular dichroism spectrophotometer for protein secondary structure analysis. This peptide or oligopeptide is studied for its biological activity, structure...
JEOL ECZ Series: Oligopeptide Research Reference
NMR spectrometer for protein structure and dynamics studies. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...
Jingzhaotoxin I: Peptide Toxin in Pharmacology Reference
Jingzhaotoxin-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for...
Jingzhaotoxin III: Peptide Toxin in Pharmacology Reference
Jingzhaotoxin-III is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide or oligopeptide is studied for its biolog...
Journal of Medicinal Chemistry
Premier journal for medicinal chemistry and drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Journal of Peptide Science: Comprehensive Peptide Reference
Journal dedicated to peptide science and technology. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...
JSTX (Joro Spider Toxin): Peptide Toxin in Pharmacology R...
Comprehensive reference for JSTX (Joro Spider Toxin), a peptide compound with applications in research and therapeutics.
Junin N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Junin N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...
JzTx 14: Peptide Toxin in Pharmacology Reference
JzTx-14 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...
JzTx 5: Peptide Toxin in Pharmacology Reference
JzTx-5 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...
JzTx I: Peptide Toxin in Pharmacology Reference
JzTx-I is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its phar...
K Pneumoniae Ndm Peptide: Oligopeptide Research Reference
A peptide associated with K Pneumoniae Ndm for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, str...
K Pneumoniae Peptide: Oligopeptide Research Reference
A peptide associated with K Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...
K9Cath: Oligopeptide Research Reference
K9Cath, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ka Resource: Oligopeptide Research Reference
The ka database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...
Kahalalide F: Oligopeptide Research Reference
Kahalalide F, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Kalata B1: Oligopeptide Research Reference
Kalata B1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Kalata B10: Oligopeptide Research Reference
kalata-B10 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...
Kalata B2: Oligopeptide Research Reference
kalata-B2 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B3: Oligopeptide Research Reference
kalata-B3 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B5: Oligopeptide Research Reference
kalata-B5 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B6: Oligopeptide Research Reference
kalata-B6 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B7: Oligopeptide Research Reference
kalata-B7 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B8: Oligopeptide Research Reference
kalata-B8 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kalata B9: Oligopeptide Research Reference
kalata-B9 is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Kallidin: Oligopeptide Research Reference
kallidin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Kallikrein Inhibitor: Enzyme in Peptide Biology Reference
kallikrein inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate sp...
Kappa Bungarotoxin: Peptide Toxin in Pharmacology Reference
kappa-bungarotoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharma...
Kappa Conotoxin PVIIA: Peptide Toxin in Pharmacology Refe...
kappa-conotoxin-PVIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its bio...
Karenia brevis: Oligopeptide Research Reference
Activates Na+ channel (site 5), persistent opening. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
kd Resource: Oligopeptide Research Reference
The kd database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...
Keratin Binding Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Keratin Binding. This analytical technique provides valuable insights into peptide struc...
Keratin intermediate filament: Comprehensive Peptide Refe...
Comprehensive reference for keratin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,
Keratin peptide: Structure, Function, and Significance
Keratin-derived peptides contain cysteine-rich sequences that form disulfide cross-links, providing structural integrity to hair, nails, and skin.
Khan Academy Amino Acids: Oligopeptide Research Reference
Educational resource on amino acids and protein structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Kidney Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Kidney Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...
Kidney Disease and Peptides: Comprehensive Peptide Reference
Learn about peptide biomarkers and therapeutic peptides for chronic kidney disease and renal fibrosis. This peptide or oligopeptide is studied for its biolog...
KIM 1 Peptide: Oligopeptide Research Reference
KIM 1 peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Kinase Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Kinase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...
Kinase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Kinase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...
kinetics Resource: Oligopeptide Research Reference
The kinetics database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Kisspeptin 10: Oligopeptide Research Reference
kisspeptin 10 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Kisspeptin 54: Oligopeptide Research Reference
kisspeptin 54 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Kisspeptin: Neuropeptide in Neuroscience Reference
Hypothalamic neuropeptide essential for puberty onset and reproductive function. This neuropeptide is involved in neurological signaling and is studied for i...
Klotho Hormone: Endogenous Peptide Hormone Reference
Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Klotho Peptide Hormone: Endogenous Peptide Hormone Reference
Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Klotho Protein Hormone: Endogenous Peptide Hormone Reference
Klotho, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Kluyveromyces lactis: Oligopeptide Research Reference
tRNA anticodon nuclease activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Knauer Azura: Oligopeptide Research Reference
HPLC system for analytical and preparative peptide purification. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
KNYLSLPTQSN: Oligopeptide Research Reference
Lyngbya majuscula. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...
koff Resource: Oligopeptide Research Reference
The koff database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
Kollaren: Oligopeptide Research Reference
Palmitoyl pentapeptide-4. Stimulates collagen synthesis. Anti-aging skincare. This peptide or oligopeptide is studied for its biological activity, structure-...
kon Resource: Oligopeptide Research Reference
The kon database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
KQNLNSDIKKQIEK: Oligopeptide Research Reference
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
KRAS Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting KRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
KRREILSRRPSYR: Oligopeptide Research Reference
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Kyotophin: Structure, Function, and Significance
Kyotophin is a dipeptide with opioid-like analgesic activity found in mammalian brain. This peptide or oligopeptide is studied for its biological activity, s...
Kyotorphin: Structure, Function, and Significance
Kyotorphin (L-tyrosyl-L-arginine) is a neuropeptide with analgesic activity, found in bovine brain. This peptide or oligopeptide is studied for its biologica...
L Monocytogenes Peptide: Oligopeptide Research Reference
A peptide associated with L Monocytogenes for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...
L Pneumophila Peptide: Oligopeptide Research Reference
A peptide associated with L Pneumophila for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
LA ICP MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using LA ICP MS. This analytical technique provides valuable insights into peptide structure, purity, and...
Laboratory Diagnostics: Oligopeptide Research Reference
Peptide-based laboratory diagnostic tests. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Lactenin: Antimicrobial Peptide Reference
lactenin is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity. Covers molecular mechanisms, biological a...
Lacticin: Antimicrobial Peptide Reference
lacticin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...
Lactoferrampin: Antimicrobial Peptide Reference
lactoferrampin is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Lactoferricin B: Oligopeptide Research Reference
Lactoferricin B, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lactoferricin: Antimicrobial Peptide Reference
Cationic antimicrobial peptide from lactoferrin with potent gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pat...
Lactoferrin Antimicrobial: Comprehensive Peptide Reference
Iron-binding glycoprotein generating antimicrobial lactoferricin fragment upon cleavage. This antimicrobial peptide demonstrates activity against pathogens a...
Lactoferrin Derivative: Antimicrobial Peptide Reference
lactoferrin-derivative is a defensin-family antimicrobial peptide with cysteine-stabilized structure and broad-spectrum activity.
Lactoferrin: Oligopeptide Research Reference
86 kDa iron-binding glycoprotein. Antimicrobial, anti-inflammatory, immunomodulatory. Found in milk, neutrophils. Covers molecular mechanisms, biological act...
Lactokinin: Structure, Function, and Significance
Lactokinins are bioactive peptides from milk proteins that inhibit angiotensin-converting enzyme, reducing blood pressure.
Ladder-frame polyether peptide
Karenia brevis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
LAG 3 Blocker: Oligopeptide Research Reference
LAG 3 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Lamination Synthesis: Analytical Technique in Peptide Res...
A peptide synthesis method using Lamination for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...
Laminin peptide: Structure, Function, and Significance
YIGSR is a laminin-derived pentapeptide that promotes cell adhesion and inhibits tumor metastasis through integrin binding.
Langevin Dynamics for Peptides
A computational method for studying peptides using Langevin Dynamics. This analytical technique provides valuable insights into peptide structure, purity, an...
Lanreotide Autogel: Oligopeptide Research Reference
Deep subcutaneous depot somatostatin analog for acromegaly and neuroendocrine tumors. This peptide or oligopeptide is studied for its biological activity, st...
Lanreotide: Oligopeptide Research Reference
lanreotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Lanreotide: Oligopeptide Research Reference
Somatostatin analog octapeptide used for acromegaly and neuroendocrine tumors with prolonged-release formulation. Covers molecular mechanisms, biological act...
Laronidase: Oligopeptide Research Reference
Laronidase, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Laser Ablation Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Laser Ablation. This analytical technique provides valuable insights into peptide structure, purity...
Lassa GP Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Lassa GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Latanoprost: Oligopeptide Research Reference
Latanoprost, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Layer By Layer Synthesis: Analytical Technique in Peptide...
A peptide synthesis method using Layer By Layer for producing peptides with specific properties. This analytical technique provides valuable insights into pe...
LC MS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using LC MS. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Learning and Memory Peptides: Comprehensive Peptide Refer...
Neuropeptides involved in synaptic plasticity and memory formation. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Lebocin (Bombyx): Oligopeptide Research Reference
Lebocin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lecanemab: Oligopeptide Research Reference
Lecanemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lectin Affinity Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Lectin Affinity. This analytical technique provides valuable insights into peptide struc...
Leech Protease Inhibitor: Oligopeptide Research Reference
Leech Protease Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Leech Thrombin Inhibitor: Oligopeptide Research Reference
Leech Thrombin Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Leek Peptide: Oligopeptide Research Reference
A bioactive peptide derived from leek with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Lefamulin: Oligopeptide Research Reference
Lefamulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Legacy: Oligopeptide Research Reference
Legacy is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...
Legumin: Oligopeptide Research Reference
Legumin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Leishmania donovani: Oligopeptide Research Reference
Lipophosphoglycan blocks phagolysosome fusion. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
Leishmania GP63 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Leishmania GP63 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...
Leishmania GP63: Oligopeptide Research Reference
Leishmania-GP63 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologica...
Lemon Peptide: Oligopeptide Research Reference
A bioactive peptide derived from lemon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Length: Neuropeptide in Neuroscience Reference
Primary Function. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential ...
Lentil Peptide: Oligopeptide Research Reference
A bioactive peptide derived from lentil with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Leptin 1-100: Peptide Fragment Reference
Comprehensive reference for leptin 1-100 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-110: Peptide Fragment Reference
Comprehensive reference for leptin 1-110 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-120: Peptide Fragment Reference
Comprehensive reference for leptin 1-120 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-130: Peptide Fragment Reference
Comprehensive reference for leptin 1-130 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-140: Peptide Fragment Reference
Comprehensive reference for leptin 1-140 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-150: Peptide Fragment Reference
Comprehensive reference for leptin 1-150 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-20: Peptide Fragment Reference
Comprehensive reference for leptin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-30: Peptide Fragment Reference
Comprehensive reference for leptin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-40: Peptide Fragment Reference
Comprehensive reference for leptin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-50: Peptide Fragment Reference
Comprehensive reference for leptin 1-50 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-60: Peptide Fragment Reference
Comprehensive reference for leptin 1-60 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-70: Peptide Fragment Reference
Comprehensive reference for leptin 1-70 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-80: Peptide Fragment Reference
Comprehensive reference for leptin 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 1-90: Peptide Fragment Reference
Comprehensive reference for leptin 1-90 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 100-160: Peptide Fragment Reference
Comprehensive reference for leptin 100-160 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin 120-160: Peptide Fragment Reference
Comprehensive reference for leptin 120-160 variant, covering molecular structure, pharmacological properties, receptor interactions,
Leptin Hormone: Endogenous Peptide Hormone Reference
Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Leptin Peptide Hormone: Endogenous Peptide Hormone Reference
Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Leptin Protein Hormone: Endogenous Peptide Hormone Reference
Leptin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
Leptin: Oligopeptide Research Reference
Leptin is a 167-amino acid hormone secreted by adipose tissue that signals energy sufficiency to the hypothalamus, suppressing appetite and regulating energy...
Lettuce Peptide: Oligopeptide Research Reference
A bioactive peptide derived from lettuce with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Leu-enkephalin: Neuropeptide in Neuroscience Reference
Leu-enkephalin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Leucine isolation (1819), protein hydrolysis studies
Leucine isolation (1819), protein hydrolysis studies is a bioactive compound with applications in peptide research and therapeutics.
Leucine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Leucine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...
Leucine Modification: Post-Translational Modification Ref...
Post-translational modifications of Leucine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...
Leucine Peptide: Oligopeptide Research Reference
Leucine (L) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...
Leucine-Enkephalin-Arg6: Neuropeptide in Neuroscience Ref...
Extended enkephalin with C-terminal arginine for increased stability. This neuropeptide is involved in neurological signaling and is studied for its roles in...
Leucine-Enkephalin: Neuropeptide in Neuroscience Reference
A 5-amino acid endogenous opioid peptide (Tyr-Gly-Gly-Phe-Leu) that preferentially activates delta-opioid receptors, mediating analgesia, mood regulation, an...
Leukemia Peptides: Oligopeptide Research Reference
Peptides associated with Leukemia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Leuphasyl: Oligopeptide Research Reference
Acetyl pentapeptide-18. Reduces expression wrinkles. Cosmetic peptide. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Leuprolide Depot Formulation: Comprehensive Peptide Refer...
Extended-release depot microsphere formulations of leuprolide providing 1-month to 12-month sustained testosterone suppression.
Leuprolide Depot: Oligopeptide Research Reference
Leuprolide Depot, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Leuprolide: Oligopeptide Research Reference
leuprolide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Leuprolide: Oligopeptide Research Reference
GnRH agonist. Prostate cancer, endometriosis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
LH Analog: Oligopeptide Research Reference
LH analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
LH Family Peptides: Oligopeptide Research Reference
Explore luteinizing hormone family peptides and their critical roles in ovulation and steroidogenesis. This peptide or oligopeptide is studied for its biolog...
LH Hormone: Endogenous Peptide Hormone Reference
LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
LH Peptide Hormone: Endogenous Peptide Hormone Reference
LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
LH Protein Hormone: Endogenous Peptide Hormone Reference
LH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
Liberty Blue: Oligopeptide Research Reference
Automated peptide synthesizer for microwave-assisted SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Liberty Prime: Oligopeptide Research Reference
High-throughput automated peptide synthesizer for parallel synthesis. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Liberty: Oligopeptide Research Reference
Automated peptide synthesizer for standard SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
LIF Hormone: Endogenous Peptide Hormone Reference
LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
LIF Peptide Hormone: Endogenous Peptide Hormone Reference
LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
LIF Protein Hormone: Endogenous Peptide Hormone Reference
LIF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
Ligase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Ligase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Lime Peptide: Oligopeptide Research Reference
A bioactive peptide derived from lime with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Linaclotide - First-in-Human (NCT00434993)
First-in-human trial of linaclotide for IBS-C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
Linaclotide - IBS-C (NCT00765882)
Phase III trial of linaclotide for IBS-C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Linzagolix: Oligopeptide Research Reference
Oral GnRH antagonist for uterine fibroids with selective estrogen suppression. This peptide or oligopeptide is studied for its biological activity, structure...
Lionfish Venom Peptides: Oligopeptide Research Reference
Lionfish Venom Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lipid Conjugate System 1: Oligopeptide Research Reference
A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Lipid Conjugate System 2: Oligopeptide Research Reference
A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Lipid Conjugate System 3: Oligopeptide Research Reference
A lipid-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chall...
Lipid Conjugation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Lipid Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into...
Lipoic Acid Peptide: Oligopeptide Research Reference
lipoic acid peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Lipopeptides: Oligopeptide Research Reference
Membrane disruption. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Liposomal Delivery: Oligopeptide Research Reference
Encapsulating peptides in liposomes for targeted delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Liposomal Peptide Delivery: Comprehensive Peptide Reference
Liposome encapsulation protecting peptides from degradation and enabling targeted delivery. This peptide or oligopeptide is studied for its biological activi...
Liposome encapsulation: Oligopeptide Research Reference
Comprehensive reference for liposome encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Liposome Formulation: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Liposome System 1: Oligopeptide Research Reference
A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Liposome System 2: Oligopeptide Research Reference
A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Liposome System 3: Oligopeptide Research Reference
A liposome-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Lipoxin A4: Oligopeptide Research Reference
lipoxin A4 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Liquid chromatography-mass spectrometry
Vitamin D, drug monitoring. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
Liquid Phase Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Liquid Phase for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
liquid-crystal for Peptides: Comprehensive Peptide Reference
Application of liquid-crystal technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Liraglutide - SCALE (NCT01272219)
SCALE trial of liraglutide for obesity management. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Liraglutide 3.0mg Obesity: Comprehensive Peptide Reference
Liraglutide 3.0mg daily for chronic weight management with BMI 30 or BMI 27 with comorbidities. This peptide or oligopeptide is studied for its biological ac...
Liraglutide for diabetes (2010), GLP-1 physiology
Liraglutide for diabetes (2010), GLP-1 physiology is a bioactive compound with applications in peptide research and therapeutics.
Liraglutide: Oligopeptide Research Reference
liraglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Liraglutide: Oligopeptide Research Reference
GLP-1 agonist. Type 2 diabetes and obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Lisinopril: Oligopeptide Research Reference
Lisinopril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lispro Pump Cartridge: Oligopeptide Research Reference
Preservative-free insulin lispro formulated for pump cartridges with stability at 37 degrees Celsius for 48 hours. Covers molecular mechanisms, biological ac...
Lithographic Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Lithographic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
lithography for Peptides: Analytical Technique in Peptide...
Application of lithography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its b...
Litorin: Antimicrobial Peptide Reference
Litorin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Littorin: Structure, Function, and Significance
Littorin is an antimicrobial peptide from the periwinkle snail with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bi...
Liver Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Liver Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Liver Cancer: Oligopeptide Research Reference
Hepatocellular carcinoma. Most common primary liver cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...
Liver Disease and Peptides: Comprehensive Peptide Reference
Discover hepatoprotective peptides and antifibrotic peptide therapies for liver cirrhosis and fatty liver disease. Covers molecular mechanisms, biological ac...
Lixisenatide Once Daily: Peptide Family Reference
Short-acting GLP-1 receptor agonist with rapid onset and short duration, primarily targeting postprandial glucose excursions.
Lixisenatide: Oligopeptide Research Reference
Short-acting GLP-1 receptor agonist derived from exendin-4 for once-daily postprandial glucose control in type 2 diabetes.
Lixisenatide: Oligopeptide Research Reference
Once-daily short-acting GLP-1 agonist from exendin-4 with C-terminal truncation for rapid onset. This peptide or oligopeptide is studied for its biological a...
Lixisenatide/Insulin Glargine: Comprehensive Peptide Refe...
Fixed-ratio combination for type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Lizard Cathelicidin: Oligopeptide Research Reference
Lizard Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lizard Defensin: Oligopeptide Research Reference
Lizard Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lizard Peptides: Oligopeptide Research Reference
Diabetes (GLP-1R), Antimicrobial, Vasodilation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Lizard Venom Kallikrein: Oligopeptide Research Reference
Lizard Venom Kallikrein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
LKLCGFNFTDGKAVNGKQKWCQ: Oligopeptide Research Reference
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
LL-37 Engineered Derivatives: Comprehensive Peptide Refer...
Engineered LL-37 derivatives with enhanced activity and reduced cytotoxicity. This antimicrobial peptide demonstrates activity against pathogens and is studi...
LL-37: Antimicrobial Peptide Reference
Only human cathelicidin antimicrobial peptide, providing broad-spectrum defense and immunomodulatory functions at mucosal surfaces.
LL-37: Antimicrobial Peptide Reference
LL-37 is the only human cathelicidin antimicrobial peptide, derived from hCAP18, with broad-spectrum activity against bacteria, viruses, and fungi plus immun...
LNPSLYD: Oligopeptide Research Reference
Semi-synthetic. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
Locked nucleic acid: Oligopeptide Research Reference
Comprehensive reference for locked nucleic acid, covering molecular structure, pharmacological properties, receptor interactions,
Lofentanil Long-Acting: Neuropeptide in Neuroscience Refe...
Extremely potent long-acting synthetic opioid analog. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function,...
Lonapegsomatropin: Oligopeptide Research Reference
PEGylated growth hormone prodrug releasing somatropin for once-weekly pediatric treatment. This peptide or oligopeptide is studied for its biological activit...
Long noncoding RNA: Oligopeptide Research Reference
Comprehensive reference for long noncoding rna, covering molecular structure, pharmacological properties, receptor interactions,
Long-Acting Formulations: Oligopeptide Research Reference
Strategies for extending peptide drug half-life. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Loop Assembly System 1: Oligopeptide Research Reference
A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Loop Assembly System 2: Oligopeptide Research Reference
A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Loop Assembly System 3: Oligopeptide Research Reference
A loop-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
LPPS (Liquid Phase Peptide Synthesis)
Comprehensive reference for LPPS (Liquid Phase Peptide Synthesis), a peptide compound with applications in research and therapeutics.
Lucensomycin: Oligopeptide Research Reference
Lucensomycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lumbricin I: Oligopeptide Research Reference
Lumbricin I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lumbricin II: Oligopeptide Research Reference
Lumbricin II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lumbricus terrestris Lysozyme: Comprehensive Peptide Refe...
Comprehensive reference for Lumbricus terrestris Lysozyme, a peptide compound with applications in research and therapeutics.
Luminescine: Oligopeptide Research Reference
Peptide that enhances skin radiance. Brightening skincare ingredient. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Lunasin: Oligopeptide Research Reference
Lunasin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lung Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Lung Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Lung Cancer: Oligopeptide Research Reference
NSCLC (85%): adenocarcinoma, squamous cell, large cell. SCLC (15%): aggressive neuroendocrine. Molecular targets: EGFR, ALK, ROS1, BRAF, KRAS G12C, MET, RET,...
Lung Disease and Peptides: Comprehensive Peptide Reference
Explore peptide therapies for respiratory conditions including COPD, asthma, and pulmonary fibrosis. This peptide or oligopeptide is studied for its biologic...
Lupus Peptides: Oligopeptide Research Reference
Peptides associated with Lupus including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological ...
Luspatercept - Anemia (NCT02631070)
Trial of luspatercept for anemia in myelodysplastic syndromes. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Luspatercept: Oligopeptide Research Reference
TGF-β superfamily ligand trap. Stimulates erythropoiesis. FDA-approved for MDS. This peptide or oligopeptide is studied for its biological activity, structur...
Luteinizing Hormone: Oligopeptide Research Reference
luteinizing hormone in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Lyase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Lyase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Lymphoma Peptides: Oligopeptide Research Reference
Peptides associated with Lymphoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Lyngbya majuscula: Oligopeptide Research Reference
Activates protein kinase C. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
lyophilization for Peptides: Comprehensive Peptide Reference
Application of lyophilization technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Lyophilization Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Lyophilization. This analytical technique provides valuable insights into peptide struct...
Lyophilization: Oligopeptide Research Reference
Lyophilization, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lypressin: Oligopeptide Research Reference
Lypressin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Lys49 PLA2: Peptide Toxin in Pharmacology Reference
Lys49-PLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacologica...
Lysine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Lysine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...
Lysine Modification: Post-Translational Modification Refe...
Post-translational modifications of Lysine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...
Lysine Peptide: Oligopeptide Research Reference
Lysine (K) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...
M Catarrhalis Peptide: Oligopeptide Research Reference
A peptide associated with M Catarrhalis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
M CSF Hormone: Endogenous Peptide Hormone Reference
M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
M CSF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting M CSF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
M CSF Peptide Hormone: Endogenous Peptide Hormone Reference
M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
M CSF Protein Hormone: Endogenous Peptide Hormone Reference
M CSF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
M Pneumoniae Peptide: Oligopeptide Research Reference
A peptide associated with M Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...
M Tuberculosis Peptide: Oligopeptide Research Reference
A peptide associated with M Tuberculosis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struc...
Mabinlin: Oligopeptide Research Reference
mabinlin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Macadamia Peptide: Oligopeptide Research Reference
A bioactive peptide derived from macadamia with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
Machine Learning for Peptides: Comprehensive Peptide Refe...
Machine learning approaches for peptide property prediction, design, and optimization. This peptide or oligopeptide is studied for its biological activity, s...
Machupo N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Machupo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Macrolactamization Synthesis: Comprehensive Peptide Refer...
A peptide synthesis method using Macrolactamization for producing peptides with specific properties. This analytical technique provides valuable insights int...
MAG1-Pokeweed: Oligopeptide Research Reference
MAG1-Pokeweed, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Magainin 1: Antimicrobial Peptide Reference
Frog skin AMP from Xenopus laevis forming voltage-dependent ion channels in bacterial membranes. This antimicrobial peptide demonstrates activity against pat...
Magainin 2: Antimicrobial Peptide Reference
Amphibian antimicrobial peptide from Xenopus laevis skin that pioneered the field of host defense peptides. This peptide or oligopeptide is studied for its b...
Magainin 2: Antimicrobial Peptide Reference
Amphipathic alpha-helical AMP from African clawed frog with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pa...
Magainin: Antimicrobial Peptide Reference
A family of antimicrobial peptides from African clawed frog skin with broad-spectrum activity against bacteria, fungi, and viruses, acting through membrane d...
Magnetic Nanoparticle Labeling Synthesis
A peptide synthesis method using Magnetic Nanoparticle Labeling for producing peptides with specific properties. Covers molecular mechanisms, biological acti...
Magnetic Separation Purification
A purification technique for separating and isolating peptides using Magnetic Separation. This analytical technique provides valuable insights into peptide s...
Maitotoxin: Oligopeptide Research Reference
Maitotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Malaria CSP Repeat: Oligopeptide Research Reference
Malaria-CSP-repeat is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biolog...
Malaria CSP Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Malaria CSP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-act...
Malaria Peptides: Oligopeptide Research Reference
Peptides associated with Malaria including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Malaria PfSPZ: Oligopeptide Research Reference
Malaria-PfSPZ is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...
Malaria: Oligopeptide Research Reference
Plasmodium parasite. Treatments: ACT, chloroquine, primaquine. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
MALDI for Peptides: Analytical Technique in Peptide Research
Understand MALDI mass spectrometry ionization techniques for peptide molecular weight determination and imaging. Covers molecular mechanisms, biological acti...
MALDI Imaging Analysis: Analytical Technique in Peptide R...
An analytical technique for characterizing peptides using MALDI Imaging. This analytical technique provides valuable insights into peptide structure, purity,...
Maleimide Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using Maleimide. This analytical technique provides valuable insights into peptide structure, ...
Mambin 1: Peptide Toxin in Pharmacology Reference
mambin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...
Mambin 2: Peptide Toxin in Pharmacology Reference
mambin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...
Mambin: Structure, Function, and Significance
Mambins are neurotoxic peptides from mamba venom with unique potassium channel blocking properties. This peptide toxin is derived from venom and studied for ...
Mammalian Neuropeptide: Oligopeptide Research Reference
Mammalian Neuropeptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Mango Peptide: Oligopeptide Research Reference
A bioactive peptide derived from mango with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
MAP 34: Antimicrobial Peptide Reference
MAP-34 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...
MAP 36: Antimicrobial Peptide Reference
MAP-36 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...
MAP 37: Antimicrobial Peptide Reference
MAP-37 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological act...
MAP Kinase Modulator: Oligopeptide Research Reference
MAP kinase modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
MAPK Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
MAPK Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
MAPK Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
MAPK Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
MAPK Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the MAPK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Maple Syrup Urine Disease: Comprehensive Peptide Reference
Inborn error of metabolism. Branched-chain α-ketoacid dehydrogenase deficiency. This peptide or oligopeptide is studied for its biological activity, structur...
Marburg GP Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Marburg GP for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Maresin 1: Oligopeptide Research Reference
maresin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Margatoxin: Peptide Toxin in Pharmacology Reference
Margatoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Marine Anti-Cancer Agent: Oligopeptide Research Reference
Marine Anti-Cancer Agent is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Marine Anti-Cancer Drug (Approved)
Marine Anti-Cancer Drug (Approved) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ac...
Marine Anti-Cancer Peptide: Comprehensive Peptide Reference
Marine Anti-Cancer Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...
Marine Anti-Inflammatory / Analgesic
Marine Anti-Inflammatory / Analgesic is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological ...
Marine Anti-Inflammatory / Neuroprotective
Marine Anti-Inflammatory / Neuroprotective is a bioactive compound with applications in peptide research and therapeutics.
Marine Cosmetic Peptide: Oligopeptide Research Reference
Marine Cosmetic Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...
Marine Organism AMPs: Antimicrobial Peptide Reference
AMPs from marine invertebrates and vertebrates for antibiotic discovery. This antimicrobial peptide demonstrates activity against pathogens and is studied fo...
Marine Peptide Drug Candidates
Overview of marine-derived peptides in clinical development including anticancer, antiviral, and anti-inflammatory agents.
Marine Peptide Drug: Oligopeptide Research Reference
Marine Peptide Drug is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
Marine Toxin / Analgesic: Oligopeptide Research Reference
Marine Toxin / Analgesic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Marine Toxin: Oligopeptide Research Reference
Marine Toxin is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activ...
Marine Venoms: Peptide Toxin in Pharmacology Reference
K+, Nav. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in research a...
Marine-Inspired Drug (Approved)
Marine-Inspired Drug (Approved) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Market: Oligopeptide Research Reference
Medium-High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...
Markov State for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Markov State. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Martini for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using Martini. This analytical technique provides valuable insights into peptide structure, purity, and characte...
Mass Spec ESI Analysis: Analytical Technique in Peptide R...
An analytical technique for characterizing peptides using Mass Spec ESI. This analytical technique provides valuable insights into peptide structure, purity,...
Mass Spec MALDI Analysis: Analytical Technique in Peptide...
An analytical technique for characterizing peptides using Mass Spec MALDI. This analytical technique provides valuable insights into peptide structure, purit...
Mass Spec Orbitrap Analysis: Comprehensive Peptide Reference
An analytical technique for characterizing peptides using Mass Spec Orbitrap. This analytical technique provides valuable insights into peptide structure, pu...
Mass Spec QTOF Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Mass Spec QTOF. This analytical technique provides valuable insights into peptide structure, purity...
Mass Spec TOF Analysis: Analytical Technique in Peptide R...
An analytical technique for characterizing peptides using Mass Spec TOF. This analytical technique provides valuable insights into peptide structure, purity,...
Mass Spectrometry (MS): Analytical Technique in Peptide R...
>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...
Mass Spectrometry for Peptides
Learn how mass spectrometry identifies and characterizes peptides through molecular weight determination and sequence analysis.
Mass Spectrometry: Oligopeptide Research Reference
Mass Spectrometry, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
mass-spectrometry for Peptides
Application of mass-spectrometry technique for peptide characterization, structure determination, or formulation. Covers molecular mechanisms, biological act...
Mast cell degranulating: Structure, Function, and Signifi...
Mast cell degranulating peptide (MCDP) from bee venom triggers histamine release from mast cells through a non-IgE mechanism.
Mastoparan (Vespula): Oligopeptide Research Reference
Mastoparan (Vespula), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Mastoparan: Antimicrobial Peptide Reference
Honeybee venom amphipathic peptide activating G-proteins and forming membrane pores. This antimicrobial peptide demonstrates activity against pathogens and i...
Mating type signaling pheromone
Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
Matrixyl 3000: Oligopeptide Research Reference
Combination of palmitoyl tripeptide-1 (Pal-Gly-Pro-Gln) and palmitoyl tetrapeptide-7 (Pal-Gly-Gln-Pro-Arg). Synergistic stimulation of collagen I, III, IV, f...
Matrixyl: Oligopeptide Research Reference
Palmitoyl pentapeptide-4. Stimulates collagen synthesis. Anti-wrinkle skincare peptide. This peptide or oligopeptide is studied for its biological activity, ...
Maurotoxin: Peptide Toxin in Pharmacology Reference
Maurotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Maximin 3: Antimicrobial Peptide Reference
Maximin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Maximin 4: Antimicrobial Peptide Reference
Maximin 4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Maximin 5: Antimicrobial Peptide Reference
Maximin 5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
maximum-tolerated-dose Resource
The maximum-tolerated-dose database or resource for peptide research, providing data on structure, function, and interactions.
Mazdutide: Oligopeptide Research Reference
Mazdutide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
MBP Tag Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using MBP Tag. This analytical technique provides valuable insights into peptide structure, pu...
MCC Resource: Oligopeptide Research Reference
The MCC database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
MCoTI-I/II: Oligopeptide Research Reference
MCoTI-I/II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
MDM2 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting MDM2 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
MDM2/MDMX Inhibitor: Oligopeptide Research Reference
MDM2/MDMX Inhibitor is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
MDMSTLADDLAC: Oligopeptide Research Reference
Nodularia spumigena. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Mechanochemical Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Mechanochemical for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Mediates cytoadherence to host endothelium
Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
Mediates receptor binding and endocytosis
Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Medium-High: Oligopeptide Research Reference
Structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical re...
Medium: Oligopeptide Research Reference
Binding mode. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
MEK Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting MEK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
MEK Inhibitor: Oligopeptide Research Reference
MEK inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Melanin-Concentrating Hormone: Comprehensive Peptide Refe...
Hypothalamic neuropeptide promoting feeding and energy conservation. This neuropeptide is involved in neurological signaling and is studied for its roles in ...
Melanin-Concentrating Hormone: Comprehensive Peptide Refe...
A 19-amino acid cyclic neuropeptide from the lateral hypothalamus that stimulates feeding and energy storage, with MCHR1 as a potential anti-obesity drug target
Melanocortin Family Peptides: Comprehensive Peptide Refer...
Learn about alpha-MSH, beta-MSH, and ACTH in pigmentation, energy balance, and inflammation. This peptide or oligopeptide is studied for its biological activ...
Melanoma Peptides: Oligopeptide Research Reference
Peptides associated with Melanoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Melanostatin: Structure, Function, and Significance
Melanostatin (MSH release-inhibiting factor) is a tripeptide that inhibits melanocyte-stimulating hormone release. Covers molecular mechanisms, biological ac...
Melanostatine: Oligopeptide Research Reference
Peptide that inhibits melanin production. Skin lightening cosmetic. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Melittin (Apis): Oligopeptide Research Reference
Melittin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Melittin: Antimicrobial Peptide Reference
Major component of bee venom that potently disrupts cell membranes, studied for antimicrobial and anticancer applications.
Melittin: Peptide Toxin in Pharmacology Reference
A 26-amino acid cytolytic peptide comprising 40-50% of honeybee (Apis mellifera) venom, with potent membrane-disrupting activity and anti-inflammatory proper...
Melon Peptide: Oligopeptide Research Reference
A bioactive peptide derived from melon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Membrane disruption, binds phosphatidylserine
Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Membrane Filtration (Tangential Flow Filtration)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Membrane Filtration: Oligopeptide Research Reference
Membrane Filtration, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Membrane permeabilization: Comprehensive Peptide Reference
Yeast antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Membrane pore formation: Oligopeptide Research Reference
Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
Membrane Selectivity AMPs: Comprehensive Peptide Reference
Structural basis for selectivity for bacterial over host cell membranes. This antimicrobial peptide demonstrates activity against pathogens and is studied fo...
Membrane Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Membrane for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...
MenB FHbp Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting MenB FHbp for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
MenB FHbp: Oligopeptide Research Reference
MenB-fHbp is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...
MenB NadA Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting MenB NadA for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
MenB NadA: Oligopeptide Research Reference
MenB-NadA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...
MenB NHba Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting MenB NHba for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
MenB NHBA: Oligopeptide Research Reference
MenB-NHBA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological acti...
Meningococcal PorA: Oligopeptide Research Reference
meningococcal-PorA is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biolog...
Meropenem/Vaborbactam: Oligopeptide Research Reference
Meropenem/Vaborbactam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Merrifield and Solid-Phase Synthesis
Bruce Merrifield's revolutionary invention of solid-phase peptide synthesis in 1963. This peptide or oligopeptide is studied for its biological activity, str...
Met-Enkephalin-Arg6-Gly7: Neuropeptide in Neuroscience Re...
Extended enkephalin from proenkephalin processing. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, be...
Met-enkephalin: Neuropeptide in Neuroscience Reference
Met-enkephalin is an endogenous pentapeptide opioid that modulates pain perception and stress responses through delta-opioid receptor activation.
Metabolic / Amylin Analog: Comprehensive Peptide Reference
Metabolic / Amylin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...
Metabolic / Biguanide (peptide combination partner)
Metabolic / Biguanide (peptide combination partner) is a bioactive compound with applications in peptide research and therapeutics.
Metabolic / Dual Incretin Agonist
Metabolic / Dual Incretin Agonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Metabolic / Enzyme Inhibition: Comprehensive Peptide Refe...
Metabolic / Enzyme Inhibition is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Metabolic / GLP-1 Agonist: Comprehensive Peptide Reference
Metabolic / GLP-1 Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...
Metabolic / Incretin Mimetic: Comprehensive Peptide Refer...
Metabolic / Incretin Mimetic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...
Metabolic / Rapid-Acting Insulin
Metabolic / Rapid-Acting Insulin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...
Metabolic / Rapid-Acting Insulin Analog
Metabolic / Rapid-Acting Insulin Analog is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...
Metabolic / Ultra-Long-Acting Insulin
Metabolic / Ultra-Long-Acting Insulin is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...
Metabolic Diseases: Oligopeptide Research Reference
Disorders of metabolism: diabetes, obesity, lipid disorders, inborn errors of metabolism (PKU, Gaucher's, Fabry's). Treatments: dietary modification, enzyme ...
Metabolic Signaling: Oligopeptide Research Reference
Metabolic Signaling is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
Metabolic Syndrome and Peptides
Discover peptide approaches to metabolic syndrome including insulin sensitizers and lipid-modulating peptides. This peptide or oligopeptide is studied for it...
Metabolic Syndrome Peptides: Comprehensive Peptide Reference
Peptides associated with Metabolic Syndrome including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...
Metabolic Syndrome: Oligopeptide Research Reference
Cluster: obesity, dyslipidemia, hyperglycemia, hypertension. Requires ≥3 of 5 criteria. Treatments: lifestyle modification, metformin, statins.
Metabolic: Oligopeptide Research Reference
Diabetes management, bone metabolism. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Metadynamics for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Metadynamics. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Metal Affinity Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Metal Affinity. This analytical technique provides valuable insights into peptide struct...
Metal Chelation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Metal Chelation for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Metalloprotease cleaves complement C3b to iC3b
Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
Metformin: Oligopeptide Research Reference
Biguanide oral antidiabetic that reduces hepatic glucose production and improves insulin sensitivity. This peptide or oligopeptide is studied for its biologi...
Methadone Opioid Maintenance: Comprehensive Peptide Refer...
Synthetic opioid for opioid use disorder treatment and pain management. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Methionine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Methionine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...
Methionine Modification: Post-Translational Modification ...
Post-translational modifications of Methionine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...
Methionine Peptide: Oligopeptide Research Reference
Methionine (M) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...
Methionine-Enkephalin: Neuropeptide in Neuroscience Refer...
Endogenous opioid with delta-selectivity and roles in pain and reward. This neuropeptide is involved in neurological signaling and is studied for its roles i...
Method: Oligopeptide Research Reference
Method is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activity, s...
Methylation (Lys/Arg): Oligopeptide Research Reference
Addition of methyl groups to lysine or arginine. Affects protein interactions. This peptide or oligopeptide is studied for its biological activity, structure...
Methyltransferase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Methyltransferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...
mg-g: Oligopeptide Research Reference
Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...
mg: Oligopeptide Research Reference
Low. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research...
MiAMP1: Oligopeptide Research Reference
MiAMP1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Micafungin: Oligopeptide Research Reference
Echinocandin antifungal for invasive fungal infections including candidemia. This peptide or oligopeptide is studied for its biological activity, structure-a...
Micelle Assembly System 1: Comprehensive Peptide Reference
A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Micelle Assembly System 2: Comprehensive Peptide Reference
A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Micelle Assembly System 3: Comprehensive Peptide Reference
A micelle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Micelle encapsulation: Oligopeptide Research Reference
Comprehensive reference for micelle encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Micelle System 1: Oligopeptide Research Reference
A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Micelle System 2: Oligopeptide Research Reference
A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Micelle System 3: Oligopeptide Research Reference
A micelle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Microcystis aeruginosa: Oligopeptide Research Reference
Inhibits protein phosphatases PP1 and PP2A. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Microdissection Analysis: Analytical Technique in Peptide...
An analytical technique for characterizing peptides using Microdissection. This analytical technique provides valuable insights into peptide structure, purit...
Microfluidic Peptide Synthesis
Continuous flow SPPS in microreactors. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Microfluidic Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Microfluidic for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
Microneedle Delivery: Oligopeptide Research Reference
Using microneedles for transdermal peptide delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...
Microneedle Peptide Delivery: Comprehensive Peptide Refer...
Dissolving microneedle arrays for transdermal peptide delivery bypassing GI degradation. This peptide or oligopeptide is studied for its biological activity,...
Microneedle: Oligopeptide Research Reference
Minutes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical rese...
MicroRNA: Oligopeptide Research Reference
Comprehensive reference for microrna, covering molecular structure, pharmacological properties, receptor interactions,
microscopy for Peptides: Analytical Technique in Peptide ...
Application of microscopy technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...
Microtubule assembly: Oligopeptide Research Reference
Comprehensive reference for microtubule assembly, covering molecular structure, pharmacological properties, receptor interactions,
Microtubule destabilizer: Oligopeptide Research Reference
Comprehensive reference for microtubule destabilizer, covering molecular structure, pharmacological properties, receptor interactions,
Microtubule dynamics: Oligopeptide Research Reference
Comprehensive reference for microtubule dynamics, covering molecular structure, pharmacological properties, receptor interactions,
Microtubule stabilizer: Oligopeptide Research Reference
Comprehensive reference for microtubule stabilizer, covering molecular structure, pharmacological properties, receptor interactions,
Microwave Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Microwave for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Microwave-Assisted SPPS: Oligopeptide Research Reference
mg-g. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Microwave-Assisted Synthesis: Comprehensive Peptide Refer...
Comprehensive reference for Microwave-Assisted Synthesis, a peptide compound with applications in research and therapeutics.
Migraine Peptides: Oligopeptide Research Reference
Peptides associated with Migraine including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologic...
Milestone 001: Oligopeptide Research Reference
1921: Discovery of insulin by Banting and Best. First peptide hormone isolated for therapeutic use. Nobel Prize 1923. Covers molecular mechanisms, biological...
Milestone 002: Oligopeptide Research Reference
1951: Frederick Sanger determines amino acid sequence of insulin. Nobel Prize 1958. This peptide or oligopeptide is studied for its biological activity, stru...
Milestone 003: Oligopeptide Research Reference
1953: Vincent du Vigneaud synthesizes oxytocin. First chemical synthesis of a peptide hormone. Nobel Prize 1955. Covers molecular mechanisms, biological acti...
Milestone 004: Oligopeptide Research Reference
1963: Robert Bruce Merrifield develops solid-phase peptide synthesis (SPPS). Revolutionizes peptide chemistry. Nobel Prize 1984.
Milestone 005: Oligopeptide Research Reference
1977: Opioid peptides (enkephalins) discovered by Kosterlitz and Hughes. Endogenous pain modulation. Nobel Prize 2004. Covers molecular mechanisms, biologica...
Milestone 006: Oligopeptide Research Reference
1982: Humulin (recombinant human insulin) approved by FDA. First biotechnology product. This peptide or oligopeptide is studied for its biological activity, ...
Milestone 007: Oligopeptide Research Reference
1987: Zasloff discovers magainins from frog skin. Opens field of antimicrobial peptides. This peptide or oligopeptide is studied for its biological activity,...
Milestone 008: Oligopeptide Research Reference
1993: First GLP-1 agonist (exenatide) discovered from Gila monster venom. Opens incretin therapy. This peptide or oligopeptide is studied for its biological ...
Milestone 009: Oligopeptide Research Reference
1998: First GnRH antagonist (cetrorelix) approved. Advances reproductive medicine. This peptide or oligopeptide is studied for its biological activity, struc...
Milestone 010: Oligopeptide Research Reference
2001: Click chemistry Nobel Prize (Sharpless, Meldal, Bertozzi). Enables bioorthogonal conjugation. This peptide or oligopeptide is studied for its biologica...
Milestone 011: Oligopeptide Research Reference
2003: First anti-TNF biologic (adalimumab) approved. Opens era of biologic immunotherapy. This peptide or oligopeptide is studied for its biological activity...
Milestone 012: Oligopeptide Research Reference
2011: First GLP-1 agonist for obesity (liraglutide/Saxenda) approved. Revolutionizes obesity treatment. This peptide or oligopeptide is studied for its biolo...
Milestone 013: Oligopeptide Research Reference
2014: First checkpoint inhibitor (ipilimumab) approved for melanoma. Opens era of cancer immunotherapy. This peptide or oligopeptide is studied for its biolo...
Milestone 014: Oligopeptide Research Reference
2017: Semaglutide (Ozempic) approved for type 2 diabetes. Once-weekly GLP-1 agonist. This peptide or oligopeptide is studied for its biological activity, str...
Milestone 015: Oligopeptide Research Reference
2020: AlphaFold2 achieves near-experimental protein structure prediction. CASP14 winner. This peptide or oligopeptide is studied for its biological activity,...
Milestone 016: Oligopeptide Research Reference
2021: Semaglutide (Wegovy) approved for obesity. STEP trials show 15% weight loss. This peptide or oligopeptide is studied for its biological activity, struc...
Milestone 017: Oligopeptide Research Reference
2022: Tirzepatide (Mounjaro) approved. Dual GIP/GLP-1 agonist with 22.5% weight loss. This peptide or oligopeptide is studied for its biological activity, st...
Milestone 018: Oligopeptide Research Reference
2023: SELECT trial shows semaglutide reduces cardiovascular events by 20% in obesity. This peptide or oligopeptide is studied for its biological activity, st...
Milestone 019: Oligopeptide Research Reference
2024: Nobel Prize in Chemistry for AlphaFold (Hassabis, Jumper). This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Milestone 020: Oligopeptide Research Reference
2025: First oral GLP-1 agonist achieves widespread adoption. Transforms diabetes treatment. This peptide or oligopeptide is studied for its biological activi...
Milestone 021: Oligopeptide Research Reference
1922: First clinical use of insulin in human patients. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...
Milestone 022: Oligopeptide Research Reference
1955: Du Vigneaud synthesizes oxytocin and vasopressin. First total synthesis of peptide hormones. This peptide or oligopeptide is studied for its biological...
Milestone 023: Oligopeptide Research Reference
1965: First total synthesis of ribonuclease A by Merrifield. Demonstrates SPPS power. This peptide or oligopeptide is studied for its biological activity, st...
Milestone 024: Oligopeptide Research Reference
1970: Schally and Guillemin isolate TRH, LH-RH, and somatostatin. Nobel Prize 1977. This peptide or oligopeptide is studied for its biological activity, stru...
Milestone 025: Oligopeptide Research Reference
1975: Enkephalins discovered. Endogenous opioid peptides identified. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Milestone 026: Oligopeptide Research Reference
1980: First monoclonal antibody (OKT3) approved. Opens era of antibody therapeutics. This peptide or oligopeptide is studied for its biological activity, str...
Milestone 027: Oligopeptide Research Reference
1985: First synthetic peptide drug (desmopressin) gains widespread use. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Milestone 028: Oligopeptide Research Reference
1990: First recombinant monoclonal antibody (abciximab) approved. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Milestone 029: Oligopeptide Research Reference
2000: Human genome sequenced. Enables genomics-driven peptide drug discovery. This peptide or oligopeptide is studied for its biological activity, structure-...
Milestone 030: Oligopeptide Research Reference
2010: First peptide-drug conjugate (brentuximab vedotin) approved. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Milk Casokinin: Oligopeptide Research Reference
milk casokinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
Milk Lactokinin: Oligopeptide Research Reference
milk lactokinin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Milk Lactorphin: Oligopeptide Research Reference
milk lactorphin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Millet Peptide: Oligopeptide Research Reference
A bioactive peptide derived from millet with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Mimetic System 1: Oligopeptide Research Reference
A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Mimetic System 2: Oligopeptide Research Reference
A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Mimetic System 3: Oligopeptide Research Reference
A mimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Mineral-Binding Peptides: Oligopeptide Research Reference
Comprehensive reference for Mineral-Binding Peptides, a peptide compound with applications in research and therapeutics.
Minibody System 1: Oligopeptide Research Reference
A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Minibody System 2: Oligopeptide Research Reference
A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Minibody System 3: Oligopeptide Research Reference
A minibody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Minibody: Oligopeptide Research Reference
Comprehensive reference for minibody, covering molecular structure, pharmacological properties, receptor interactions,
Minutes: Oligopeptide Research Reference
Non-invasive. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
Miraculin: Oligopeptide Research Reference
miraculin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
MIT OCW Biochemistry: Oligopeptide Research Reference
MIT OpenCourseWare resource on biochemistry. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Mixed: Oligopeptide Research Reference
Binding + cleavage or modification + binding. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
MMP Inhibitor: Enzyme in Peptide Biology Reference
MMP inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifici...
MOD-001: Post-Translational Modification Reference
Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-003: Post-Translational Modification Reference
Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-005: Post-Translational Modification Reference
Backbone. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-007: Post-Translational Modification Reference
Side Chain. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...
MOD-009: Post-Translational Modification Reference
Side Chain. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized ther...
MOD-011: Post-Translational Modification Reference
Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-013: Post-Translational Modification Reference
Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-015: Post-Translational Modification Reference
Terminal. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized therap...
MOD-017: Post-Translational Modification Reference
Cyclization. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized the...
MOD-019: Post-Translational Modification Reference
Cyclization. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized the...
Modeccin: Oligopeptide Research Reference
Modeccin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ModelArchive: Oligopeptide Research Reference
Database of computational models for biological systems. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Modification: Oligopeptide Research Reference
Covalent modification (disulfide, conformational). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Modulates glucose sensing GPCR pathway
Yeast signaling peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Mojave Toxin: Oligopeptide Research Reference
Mojave Toxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Molding Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Molding for producing peptides with specific properties. This analytical technique provides valuable insights into peptide s...
Molecular Dynamics for Peptides
A computational method for studying peptides using Molecular Dynamics. This analytical technique provides valuable insights into peptide structure, purity, a...
Molecular Dynamics for Peptides
Explore computational molecular dynamics simulations for predicting peptide conformational behavior and folding. Covers molecular mechanisms, biological acti...
Molecular Dynamics: Oligopeptide Research Reference
High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Molecular Glue System 1: Oligopeptide Research Reference
A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Molecular Glue System 2: Oligopeptide Research Reference
A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Molecular Glue System 3: Oligopeptide Research Reference
A molecular-glue-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Molecular glue: Oligopeptide Research Reference
Comprehensive reference for molecular glue, covering molecular structure, pharmacological properties, receptor interactions,
Molecular Mechanics for Peptides
A computational method for studying peptides using Molecular Mechanics. This analytical technique provides valuable insights into peptide structure, purity, ...
Molten Globule System 1: Oligopeptide Research Reference
A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Molten Globule System 2: Oligopeptide Research Reference
A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Molten Globule System 3: Oligopeptide Research Reference
A molten-globule-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Momordin I: Oligopeptide Research Reference
momordin-I is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...
Momordin II: Oligopeptide Research Reference
momordin-II is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity.
Monellin: Oligopeptide Research Reference
monellin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Monte Carlo for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using Monte Carlo. This analytical technique provides valuable insights into peptide structure, purity, and char...
morbidity Resource: Oligopeptide Research Reference
The morbidity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Moricin (Bombyx): Oligopeptide Research Reference
Moricin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Moronecidin: Oligopeptide Research Reference
Moronecidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Morphiceptin: Neuropeptide in Neuroscience Reference
morphiceptin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Morphine-3-Glucuronide: Neuropeptide in Neuroscience Refe...
Morphine metabolite with neuroexcitatory effects opposing M6G. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Morphine-6-Glucuronide: Neuropeptide in Neuroscience Refe...
Active metabolite of morphine with potent mu-opioid agonist activity. This neuropeptide is involved in neurological signaling and is studied for its roles in...
Morpholino oligomer: Oligopeptide Research Reference
Comprehensive reference for morpholino oligomer, covering molecular structure, pharmacological properties, receptor interactions,
Morpholino-peptide conjugate: Comprehensive Peptide Refer...
Comprehensive reference for morpholino-peptide conjugate, covering molecular structure, pharmacological properties, receptor interactions,
mortality Resource: Oligopeptide Research Reference
The mortality database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Motilin 1-10: Peptide Fragment Reference
Comprehensive reference for motilin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-12: Peptide Fragment Reference
Comprehensive reference for motilin 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-14: Peptide Fragment Reference
Comprehensive reference for motilin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-22: Peptide Fragment Reference
Comprehensive reference for motilin 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-4: Peptide Fragment Reference
Comprehensive reference for motilin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-6: Peptide Fragment Reference
Comprehensive reference for motilin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 1-8: Peptide Fragment Reference
Comprehensive reference for motilin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 13-22: Peptide Fragment Reference
Comprehensive reference for motilin 13-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin 9-22: Peptide Fragment Reference
Comprehensive reference for motilin 9-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin erythromycin-analog: Comprehensive Peptide Reference
Comprehensive reference for motilin erythromycin-analog variant, covering molecular structure, pharmacological properties, receptor interactions,
Motilin family / Gut hormone: Comprehensive Peptide Refer...
Motilin family / Gut hormone is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...
Motilin Hormone: Endogenous Peptide Hormone Reference
Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Motilin Peptide Hormone: Endogenous Peptide Hormone Refer...
Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Motilin Protein Hormone: Endogenous Peptide Hormone Refer...
Motilin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Motilin: Endogenous Peptide Hormone Reference
22-amino acid gut hormone that stimulates gastric and intestinal motility through the migrating motor complex. This peptide or oligopeptide is studied for it...
Motor protein dynein: Oligopeptide Research Reference
Comprehensive reference for motor protein dynein, covering molecular structure, pharmacological properties, receptor interactions,
Motor protein kinesin: Oligopeptide Research Reference
Comprehensive reference for motor protein kinesin, covering molecular structure, pharmacological properties, receptor interactions,
Motor protein myosin: Oligopeptide Research Reference
Comprehensive reference for motor protein myosin, covering molecular structure, pharmacological properties, receptor interactions,
Mouse Beta-Defensin 3: Antimicrobial Peptide Reference
Inducible mouse beta-defensin with chemotactic and antimicrobial functions. This antimicrobial peptide demonstrates activity against pathogens and is studied...
Mouse Cathelicidin CRAMP: Antimicrobial Peptide Reference
Mouse equivalent of human LL-37 with antimicrobial and immunomodulatory properties. This antimicrobial peptide demonstrates activity against pathogens and is...
MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSN...
Saccharomyces cerevisiae. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
mRNA delivery: Oligopeptide Research Reference
Comprehensive reference for mrna delivery, covering molecular structure, pharmacological properties, receptor interactions,
MRNA System 1: Oligopeptide Research Reference
A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
MRNA System 2: Oligopeptide Research Reference
A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
MRNA System 3: Oligopeptide Research Reference
A mRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
Ms Autoimmune Peptides: Oligopeptide Research Reference
Peptides associated with Ms Autoimmune including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...
Ms Peptides: Oligopeptide Research Reference
Peptides associated with Ms including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological act...
MSH alpha-1-10: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH alpha-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH alpha-1-13: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH alpha-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH alpha-1-4: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH alpha-1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH alpha-1-5: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH alpha-1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH alpha-1-8: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH alpha-1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH beta-1-13: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH beta-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH beta-1-18: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH beta-1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH beta-1-22: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH beta-1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH gamma-1-10: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH gamma-1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH gamma-1-13: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH gamma-1-13 variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH Hormone: Endogenous Peptide Hormone Reference
MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
MSH NDP-MSH: Endogenous Peptide Hormone Reference
Comprehensive reference for MSH NDP-MSH variant, covering molecular structure, pharmacological properties, receptor interactions,
MSH Peptide Hormone: Endogenous Peptide Hormone Reference
MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
MSH Protein Hormone: Endogenous Peptide Hormone Reference
MSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
MTOR Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting MTOR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
MTOR Modulator: Oligopeptide Research Reference
mTOR modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
mTOR Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
mTOR Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
mTOR Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
mTOR Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
mTOR Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the mTOR signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Mu Conotoxin GIIIA: Peptide Toxin in Pharmacology Reference
mu-conotoxin-GIIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...
Mu Conotoxin GIIIB: Peptide Toxin in Pharmacology Reference
mu-conotoxin-GIIIB is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...
Mu Conotoxin GIIIC: Peptide Toxin in Pharmacology Reference
mu-conotoxin-GIIIC is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolog...
Mu-Conotoxin MrVIB: Peptide Toxin in Pharmacology Reference
Sodium channel blocker from Conus magus with local anesthetic potential. This peptide toxin is derived from venom and studied for its pharmacological activit...
Mucoadhesive Peptide Systems: Comprehensive Peptide Refer...
Mucoadhesive formulations adhering to GI mucosa for extended peptide absorption. This peptide or oligopeptide is studied for its biological activity, structu...
Mucus-Penetrating Peptide Delivery
Learn nanoparticle designs that penetrate mucosal barriers for enhanced peptide absorption at mucosal sites. This peptide or oligopeptide is studied for its ...
Multi Head Attention for Peptides
A computational method for studying peptides using Multi Head Attention. This analytical technique provides valuable insights into peptide structure, purity,...
Multi-Target Peptides: Oligopeptide Research Reference
Multi-Target Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
MultiPep: Oligopeptide Research Reference
MultiPep, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Multiple Myeloma: Oligopeptide Research Reference
Plasma cell malignancy. Monoclonal protein, bone lesions, anemia. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Multiple Sclerosis and Peptides
Explore peptide immunotherapies for multiple sclerosis targeting myelin-specific immune responses. This peptide or oligopeptide is studied for its biological...
Multiple Sclerosis: Oligopeptide Research Reference
Chronic autoimmune demyelinating disease of the central nervous system. Relapsing-remitting (85% initially), secondary progressive, primary progressive. Path...
multipole Resource: Oligopeptide Research Reference
The multipole database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Mulundocandin: Oligopeptide Research Reference
Mulundocandin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Murepavadin: Oligopeptide Research Reference
Murepavadin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Muromonab-CD3: Oligopeptide Research Reference
First monoclonal antibody approved for clinical use, targeting CD3 for acute transplant rejection reversal. This peptide or oligopeptide is studied for its b...
Muscarine: Oligopeptide Research Reference
Muscarine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Muscimol: Oligopeptide Research Reference
Muscimol, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Musculoskeletal / Anabolic Bone Agent
Musculoskeletal / Anabolic Bone Agent is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological...
Mussel Antimicrobial Peptides: Comprehensive Peptide Refe...
AMPs from blue mussel hemolymph defending against marine pathogens. This antimicrobial peptide demonstrates activity against pathogens and is studied for its...
Myasthenia Graves Peptides: Comprehensive Peptide Reference
Peptides associated with Myasthenia Graves including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...
Myeloma Peptides: Oligopeptide Research Reference
Peptides associated with Myeloma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Myocardial Infarction: Oligopeptide Research Reference
Acute myocardial necrosis from prolonged ischemia. STEMI: complete coronary occlusion, ST elevation on ECG, troponin elevation. NSTEMI: partial occlusion, no...
Myoglobin: Oligopeptide Research Reference
17.8 kDa heme-containing oxygen-binding protein released from damaged muscle. Normal: <85 ng/mL (male), <75 ng/mL (female). Earliest biomarker of MI (rises 1...
Myriocin iridium: Oligopeptide Research Reference
Inhibits serine palmitoyltransferase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Myrmicacin (Myrmica): Oligopeptide Research Reference
Myrmicacin (Myrmica), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Myticus: Structure, Function, and Significance
Myticus peptides are antimicrobial peptides from mussel hemolymph with antifungal and antibacterial properties. Covers molecular mechanisms, biological activ...
Myxinidin: Oligopeptide Research Reference
Myxinidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
N Gonorrhoeae Peptide: Oligopeptide Research Reference
A peptide associated with N Gonorrhoeae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
N Meningitidis Peptide: Oligopeptide Research Reference
A peptide associated with N Meningitidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struc...
N Terminal Mod System 1: Oligopeptide Research Reference
A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
N Terminal Mod System 2: Oligopeptide Research Reference
A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
N Terminal Mod System 3: Oligopeptide Research Reference
A N-terminal-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
N-Acylation: Oligopeptide Research Reference
Addition of acyl groups to N-terminus. Modifies pharmacokinetic properties. This peptide or oligopeptide is studied for its biological activity, structure-ac...
N-Glycosylation of Peptides: Comprehensive Peptide Reference
Comprehensive guide to N-glycosylation modifications on asparagine residues in peptide biology. This modification affects peptide stability, receptor binding...
N-Methylation: Oligopeptide Research Reference
Addition of methyl group to backbone nitrogen. Increases proteolytic resistance. This peptide or oligopeptide is studied for its biological activity, structu...
N-Terminal Acetylation: Oligopeptide Research Reference
Addition of acetyl group to N-terminus. Protects against aminopeptidase degradation. This peptide or oligopeptide is studied for its biological activity, str...
N-Terminal PEGylation: Post-Translational Modification Re...
N-Terminal PEGylation, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
N-Terminal Pyroglutamate: Oligopeptide Research Reference
Cyclization of N-terminal glutamine to pyroglutamic acid. Protects against degradation. This peptide or oligopeptide is studied for its biological activity, ...
Na+ channel blocker with N-hydroxylation
Dinoflagellate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
NAC Dipeptide: Oligopeptide Research Reference
NAC dipeptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Nafarelin: Oligopeptide Research Reference
nafarelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Nafarelin: Oligopeptide Research Reference
Nasal GnRH agonist for endometriosis pain and central precocious puberty. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Nafithromycin: Oligopeptide Research Reference
Nafithromycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Nalmefene Alcohol Antagonist: Comprehensive Peptide Refer...
Long-acting opioid antagonist for alcohol use disorder. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...
Naloxone Opioid Antagonist: Comprehensive Peptide Reference
Competitive opioid antagonist for emergency overdose reversal. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Naltrexone Maintenance: Neuropeptide in Neuroscience Refe...
Long-acting oral opioid antagonist for addiction and alcohol treatment. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Nanobody Conjugation Synthesis
A peptide synthesis method using Nanobody Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Nanobody System 1: Oligopeptide Research Reference
A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Nanobody System 2: Oligopeptide Research Reference
A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Nanobody System 3: Oligopeptide Research Reference
A nanobody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Nanobody: Oligopeptide Research Reference
Comprehensive reference for nanobody, covering molecular structure, pharmacological properties, receptor interactions,
Nanocrystalline Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Nanocrystalline for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Nanoemulsion Peptide Delivery: Comprehensive Peptide Refe...
Nanoemulsion systems for improving peptide oral bioavailability. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Nanoparticle Delivery: Oligopeptide Research Reference
Encapsulating peptides in nanoparticles for targeted delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Nanoparticle encapsulation: Comprehensive Peptide Reference
Comprehensive reference for nanoparticle encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Nanoparticle Formulation: Oligopeptide Research Reference
Comprehensive reference for Nanoparticle Formulation, a peptide compound with applications in research and therapeutics.
Nanoparticle Oral Peptide: Comprehensive Peptide Reference
Polymeric nanoparticles protecting and delivering peptides through intestinal barrier. This peptide or oligopeptide is studied for its biological activity, s...
Nanoparticle Peptide Delivery: Comprehensive Peptide Refe...
Understand nanoparticle encapsulation strategies for protecting and delivering peptide drugs to target tissues. Covers molecular mechanisms, biological activ...
Nanoparticle Self Assembly System 1
A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
Nanoparticle Self Assembly System 2
A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
Nanoparticle Self Assembly System 3
A nanoparticle-self-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.
Nanoparticle System 1: Oligopeptide Research Reference
A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Nanoparticle System 2: Oligopeptide Research Reference
A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Nanoparticle System 3: Oligopeptide Research Reference
A nanoparticle-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challeng...
Nanoparticle: Oligopeptide Research Reference
Hours. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resear...
Nanotechnology: Oligopeptide Research Reference
Peptide-based nanotechnology applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Narcolepsy Peptides: Oligopeptide Research Reference
Peptides associated with Narcolepsy including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Nasal delivery system: Oligopeptide Research Reference
Comprehensive reference for nasal delivery system, covering molecular structure, pharmacological properties, receptor interactions,
Nasal Delivery: Oligopeptide Research Reference
Delivering peptides through nasal mucosa for brain targeting. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...
Nasal Peptide Delivery: Oligopeptide Research Reference
Explore intranasal peptide delivery routes for bypassing first-pass metabolism and achieving brain targeting. This peptide or oligopeptide is studied for its...
Nasal System 1: Oligopeptide Research Reference
A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Nasal System 2: Oligopeptide Research Reference
A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Nasal System 3: Oligopeptide Research Reference
A nasal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Nasal: Oligopeptide Research Reference
Minutes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical rese...
Natamycin: Oligopeptide Research Reference
Natamycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Native Chemical Ligation (NCL)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Native Chemical Ligation Synthesis
A peptide synthesis method using Native Chemical Ligation for producing peptides with specific properties. This peptide or oligopeptide is studied for its bi...
Native Chemical Ligation: Oligopeptide Research Reference
Cys + thioester → native peptide bond. Enables protein synthesis up to ~200 aa. This peptide or oligopeptide is studied for its biological activity, structur...
Native PAGE Analysis: Analytical Technique in Peptide Res...
An analytical technique for characterizing peptides using Native PAGE. This analytical technique provides valuable insights into peptide structure, purity, a...
Natriuretic Peptide Family: Comprehensive Peptide Reference
Explore ANP, BNP, and CNP natriuretic peptides in cardiovascular and renal homeostasis. This peptide or oligopeptide is studied for its biological activity, ...
NCBI GenBank: Oligopeptide Research Reference
Genetic sequence database maintained by NCBI. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
NCBI Gene: Oligopeptide Research Reference
Gene database with information about gene structure, function, and expression. This peptide or oligopeptide is studied for its biological activity, structure...
NCLNGGYCPGQ: Oligopeptide Research Reference
Tetrahymena thermophila. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
NDFVNKLNKLIEN: Oligopeptide Research Reference
Plasmodium falciparum. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
NEM Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using NEM. This analytical technique provides valuable insights into peptide structure, purity...
Nematicidal Peptides: Oligopeptide Research Reference
Nematicidal Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Nematode Antifungal / Nematicidal
Nematode Antifungal / Nematicidal is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Nematode Defense Peptides: Comprehensive Peptide Reference
Comprehensive reference for Nematode Defense Peptides, a peptide compound with applications in research and therapeutics.
Nematode Excretory Peptides: Comprehensive Peptide Reference
Comprehensive reference for Nematode Excretory Peptides, a peptide compound with applications in research and therapeutics.
Nematode Insulin-like Peptide: Comprehensive Peptide Refe...
Nematode Insulin-like Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Nematode Neuropeptide / FMRFamide
Nematode Neuropeptide / FMRFamide is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Nematode Neuropeptide / NLP: Comprehensive Peptide Reference
Nematode Neuropeptide / NLP is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...
Nematode Parasitic / Secreted: Comprehensive Peptide Refe...
Nematode Parasitic / Secreted is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its...
Nematode Parasitic / Surface: Comprehensive Peptide Refer...
Nematode Parasitic / Surface is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its ...
Nematode Secreted Peptides: Comprehensive Peptide Reference
Comprehensive reference for Nematode Secreted Peptides, a peptide compound with applications in research and therapeutics.
Nematode Surface Peptides: Comprehensive Peptide Reference
Comprehensive reference for Nematode Surface Peptides, a peptide compound with applications in research and therapeutics.
Neoendorphin Alpha: Neuropeptide in Neuroscience Reference
neoendorphin-alpha is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Neoendorphin Beta: Neuropeptide in Neuroscience Reference
neoendorphin-beta is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Neonatal AMPs: Antimicrobial Peptide Reference
Immature defensin expression in neonates contributing to infection susceptibility. This antimicrobial peptide demonstrates activity against pathogens and is ...
Neosaxitoxin: Oligopeptide Research Reference
Neosaxitoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Nephrotoxicity: Oligopeptide Research Reference
Kidney damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Neprilysin Inhibitor: Enzyme in Peptide Biology Reference
neprilysin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate sp...
Nerve Growth Factor 1-118: Comprehensive Peptide Reference
Comprehensive reference for nerve growth factor 1-118, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor 1-30: Oligopeptide Research Reference
Comprehensive reference for nerve growth factor 1-30, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor 1-50: Oligopeptide Research Reference
Comprehensive reference for nerve growth factor 1-50, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor 1-70: Oligopeptide Research Reference
Comprehensive reference for nerve growth factor 1-70, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor 1-90: Oligopeptide Research Reference
Comprehensive reference for nerve growth factor 1-90, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor fragment-1-10
Comprehensive reference for nerve growth factor fragment-1-10, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor fragment-20-50
Comprehensive reference for nerve growth factor fragment-20-50, covering molecular structure, pharmacological properties, receptor interactions,
Nerve Growth Factor fragment-50-118
Comprehensive reference for nerve growth factor fragment-50-118, covering molecular structure, pharmacological properties, receptor interactions,
Nesiritide: Oligopeptide Research Reference
nesiritide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Nesiritide: Oligopeptide Research Reference
Recombinant B-type natriuretic peptide for acute decompensated heart failure, promoting vasodilation and natriuresis. Covers molecular mechanisms, biological...
Nesiritide: Oligopeptide Research Reference
Recombinant BNP for acute decompensated heart failure reducing cardiac filling pressures. This peptide or oligopeptide is studied for its biological activity...
Nestin intermediate filament: Comprehensive Peptide Refer...
Comprehensive reference for nestin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,
Netrin 1 Mimetic: Oligopeptide Research Reference
netrin 1 mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Neuregulin Hormone: Endogenous Peptide Hormone Reference
Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Neuregulin Peptide Hormone: Comprehensive Peptide Reference
Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Neuregulin Protein Hormone: Comprehensive Peptide Reference
Neuregulin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Neurodegeneration / Protein Misfolding
Neurodegeneration / Protein Misfolding is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologica...
Neuroendocrine Tumors: Oligopeptide Research Reference
Neuroendocrine Tumors, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neurofilament Light Chain (NfL)
Comprehensive reference for Neurofilament Light Chain (NfL), a peptide compound with applications in research and therapeutics.
Neurohypophysial peptide: Neuropeptide in Neuroscience Re...
Neurohypophysial peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Neurokinin A: Neuropeptide in Neuroscience Reference
Neurokinin A is a tachykinin peptide that activates NK2 receptors to regulate airway function, gastrointestinal motility, and inflammatory responses.
Neurokinin B: Neuropeptide in Neuroscience Reference
neurokinin-B is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biolog...
Neurological Disorders: Oligopeptide Research Reference
Diseases of the nervous system: neurodegenerative (Alzheimer's, Parkinson's, ALS), autoimmune (MS), vascular (stroke), epileptic, psychiatric (depression, sc...
Neurological: Oligopeptide Research Reference
AD diagnosis, neurodegeneration, prion disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Neurology / Neuromuscular Blocker
Neurology / Neuromuscular Blocker is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Neurology/Pain: Oligopeptide Research Reference
Clinical trials for neurological and pain conditions. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...
Neuromedin B: Neuropeptide in Neuroscience Reference
Bombesin-related neuropeptide with roles in satiety and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles...
Neuromedin U: Neuropeptide in Neuroscience Reference
Neuropeptide expressed in gut and brain regulating energy homeostasis. This neuropeptide is involved in neurological signaling and is studied for its roles i...
Neuropathic Pain Peptides: Comprehensive Peptide Reference
Peptides associated with Neuropathic Pain including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its ...
Neuropeptide B (NPB): Neuropeptide in Neuroscience Reference
Neuropeptide B (NPB), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neuropeptide B: Neuropeptide in Neuroscience Reference
Hypothalamic neuropeptide involved in feeding regulation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain funct...
Neuropeptide B/W family: Neuropeptide in Neuroscience Ref...
ID. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
Neuropeptide FF: Neuropeptide in Neuroscience Reference
Octapeptide with opioid-modulating and cardiovascular effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Neuropeptide Gamma: Neuropeptide in Neuroscience Reference
neuropeptide-gamma is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its ...
Neuropeptide K: Neuropeptide in Neuroscience Reference
neuropeptide-K is a neuropeptide involved in pain signaling, inflammation, or cardiovascular regulation. This peptide or oligopeptide is studied for its biol...
Neuropeptide S (NPS): Neuropeptide in Neuroscience Reference
Neuropeptide S (NPS), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neuropeptide S: Neuropeptide in Neuroscience Reference
A 20-amino acid neuropeptide that promotes wakefulness and anxiolysis through NPSR1 receptor activation, with genetic variants linked to asthma and anxiety.
Neuropeptide Structure: Oligopeptide Research Reference
Neuropeptide Structure is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Neuropeptide W (NPW): Neuropeptide in Neuroscience Reference
Neuropeptide W (NPW), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neuropeptide W: Neuropeptide in Neuroscience Reference
Hypothalamic neuropeptide regulating energy homeostasis and feeding. This neuropeptide is involved in neurological signaling and is studied for its roles in ...
Neuropeptide Y (NPY): Neuropeptide in Neuroscience Reference
Neuropeptide Y (NPY), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neuropeptide Y family / Gut hormone
Neuropeptide Y family / Gut hormone is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Neuropeptide Y Family Peptides
Explore NPY, PYY, and pancreatic polypeptide in appetite regulation and energy homeostasis. This peptide or oligopeptide is studied for its biological activi...
Neuropeptide Y: Neuropeptide in Neuroscience Reference
A 36-amino acid neuropeptide and the most potent known appetite stimulant, playing central roles in energy homeostasis, stress response, and circadian rhythms.
Neuropilin 1 Antagonist: Oligopeptide Research Reference
neuropilin 1 antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Neurotensin: Neuropeptide in Neuroscience Reference
Neurotensin is a 13-amino acid neuropeptide that modulates dopaminergic signaling, regulates thermoregulation, and functions as both a neurotransmitter and g...
Neurotoxicity: Oligopeptide Research Reference
Nervous system damage caused by peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
NeuroVax: Oligopeptide Research Reference
NeuroVax, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Neurturin Hormone: Endogenous Peptide Hormone Reference
Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Neurturin Peptide Hormone: Comprehensive Peptide Reference
Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Neurturin Protein Hormone: Comprehensive Peptide Reference
Neurturin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Neutralizing Antibodies: Oligopeptide Research Reference
Antibodies that neutralize the pharmacological activity of therapeutic peptides. This peptide or oligopeptide is studied for its biological activity, structu...
Neutravidin Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Neutravidin. This analytical technique provides valuable insights into peptide structure...
NeuVax (Nelipepimut-S): Oligopeptide Research Reference
NeuVax (Nelipepimut-S), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
neXtProt: Oligopeptide Research Reference
Protein knowledge database with expert annotation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
NF KB Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting NF KB Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
NF KB Modulator: Oligopeptide Research Reference
NF kB modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
NF-kB Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
NF-kB Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
NF-kB Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
NF-kB Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
NF-kB Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the NF-kB signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
NGAL Peptide: Oligopeptide Research Reference
NGAL peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
NGF Hormone: Endogenous Peptide Hormone Reference
NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NGF Mimetic: Oligopeptide Research Reference
NGF mimetic in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
NGF Peptide Hormone: Endogenous Peptide Hormone Reference
NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NGF Protein Hormone: Endogenous Peptide Hormone Reference
NGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NGLFNGLNNLNN: Oligopeptide Research Reference
Coleps hirtus. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
Nigrocin: Antimicrobial Peptide Reference
AMP from frog skin with multiple tryptophan residues for membrane insertion. This antimicrobial peptide demonstrates activity against pathogens and is studie...
Nipah F Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Nipah F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Nisi: Structure, Function, and Significance
Nisin-like peptides from Asian frog skin exhibit broad-spectrum antimicrobial activity with minimal hemolytic activity. Covers molecular mechanisms, biologic...
Nisin A: Antimicrobial Peptide Reference
nisin-a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against ...
Nisin Z: Antimicrobial Peptide Reference
nisin-z is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against ...
Nisin: Antimicrobial Peptide Reference
Lantibiotic peptide from Lactococcus lactis used as a food preservative, with unique lipid II targeting mechanism. Covers molecular mechanisms, biological ac...
Nisin: Antimicrobial Peptide Reference
Nisin is a lantibiotic peptide produced by Lactococcus lactis, used as a food preservative since 1969, that kills gram-positive bacteria by binding lipid II ...
Nitric oxide signaling, PDE enzyme family
Nitric oxide signaling, PDE enzyme family is a bioactive compound with applications in peptide research and therapeutics.
Nivolumab: Oligopeptide Research Reference
nivolumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
NK-Lysin Antimicrobial Domain: Comprehensive Peptide Refe...
Antimicrobial domain of porcine NK-lysin with membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathogens and is studied...
NKLNDLNRNLND: Oligopeptide Research Reference
Leishmania major. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
NLP-1 (C. elegans): Oligopeptide Research Reference
NLP-1 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-2 (C. elegans): Oligopeptide Research Reference
NLP-2 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-3 (C. elegans): Oligopeptide Research Reference
NLP-3 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-4 (C. elegans): Oligopeptide Research Reference
NLP-4 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-5 (C. elegans): Oligopeptide Research Reference
NLP-5 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-6 (C. elegans): Oligopeptide Research Reference
NLP-6 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-7 (C. elegans): Oligopeptide Research Reference
NLP-7 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-8 (C. elegans): Oligopeptide Research Reference
NLP-8 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLP-9 (C. elegans): Oligopeptide Research Reference
NLP-9 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NLSNINNNLSTLLE: Oligopeptide Research Reference
Plasmodium falciparum. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
NMF for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using NMF. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...
NMR 1D Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR 1D. This analytical technique provides valuable insights into peptide structure, purity, and ch...
NMR 2D Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR 2D. This analytical technique provides valuable insights into peptide structure, purity, and ch...
NMR CBCACONH Analysis: Analytical Technique in Peptide Re...
An analytical technique for characterizing peptides using NMR CBCACONH. This analytical technique provides valuable insights into peptide structure, purity, ...
NMR COSY Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR COSY. This analytical technique provides valuable insights into peptide structure, purity, and ...
NMR for Peptides: Analytical Technique in Peptide Research
Application of NMR technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...
NMR HACACB Analysis: Analytical Technique in Peptide Rese...
An analytical technique for characterizing peptides using NMR HACACB. This analytical technique provides valuable insights into peptide structure, purity, an...
NMR HNCA Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR HNCA. This analytical technique provides valuable insights into peptide structure, purity, and ...
NMR HNCO Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR HNCO. This analytical technique provides valuable insights into peptide structure, purity, and ...
NMR HSQC Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR HSQC. This analytical technique provides valuable insights into peptide structure, purity, and ...
NMR NOESY Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using NMR NOESY. This analytical technique provides valuable insights into peptide structure, purity, and...
NMR Spectroscopy for Peptides: Comprehensive Peptide Refe...
Explore NMR spectroscopy techniques for determining peptide three-dimensional structure and dynamics in solution. Covers molecular mechanisms, biological act...
NMR Spectroscopy: Analytical Technique in Peptide Research
>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...
Nociceptin 1-13: Peptide Fragment Reference
Minimal active fragment of nociceptin for ORL1 receptor activation. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Nociceptin ORL1 Receptor: Receptor Pharmacology Reference
ORL1 receptor activated by nociceptin in pain, anxiety, and reward. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Nociceptin: Neuropeptide in Neuroscience Reference
Endogenous ORL1 receptor agonist structurally related to dynorphin. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Nociceptin/Orphanin FQ: Neuropeptide in Neuroscience Refe...
Nociceptin/Orphanin FQ, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Nocistatin: Neuropeptide in Neuroscience Reference
Prodynorphin-derived peptide modulating nociceptin effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fun...
Nodularia spumigena: Oligopeptide Research Reference
Inhibits PP1 and PP2A, smaller cyclic structure. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Normal Mode for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using Normal Mode. This analytical technique provides valuable insights into peptide structure, purity, and char...
Normal Phase Analysis: Analytical Technique in Peptide Re...
An analytical technique for characterizing peptides using Normal Phase. This analytical technique provides valuable insights into peptide structure, purity, ...
Notch Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Notch Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
Notch Modulator: Oligopeptide Research Reference
Notch modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Notch Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Notch Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Notch Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Notch Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Notch Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the Notch signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Notexin: Peptide Toxin in Pharmacology Reference
Notexin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Novo Nordisk: Oligopeptide Research Reference
Semaglutide, Liraglutide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Noxiustoxin: Peptide Toxin in Pharmacology Reference
Noxiustoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NP-002: Neuropeptide in Neuroscience Reference
5. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...
NP-004: Neuropeptide in Neuroscience Reference
17. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-006: Neuropeptide in Neuroscience Reference
17. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-008: Neuropeptide in Neuroscience Reference
37. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-010: Neuropeptide in Neuroscience Reference
34. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-012: Neuropeptide in Neuroscience Reference
28. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-014: Neuropeptide in Neuroscience Reference
28. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-016: Neuropeptide in Neuroscience Reference
8. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...
NP-018: Neuropeptide in Neuroscience Reference
22. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-020: Neuropeptide in Neuroscience Reference
14. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-022: Neuropeptide in Neuroscience Reference
10. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-024: Neuropeptide in Neuroscience Reference
39. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-026: Neuropeptide in Neuroscience Reference
9. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic app...
NP-028: Neuropeptide in Neuroscience Reference
20. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NP-030: Neuropeptide in Neuroscience Reference
23. This neuropeptide is involved in neurological signaling and is studied for its roles in brain function, behavior regulation, and potential therapeutic ap...
NPH Insulin (Isophane): Peptide Family Reference
Intermediate-acting insulin preparation using protamine to create crystalline complexes providing 12-18 hour basal coverage.
NPH Insulin: Oligopeptide Research Reference
Intermediate-acting isophane insulin with protamine suspension providing peak action at 4-10 hours. This peptide or oligopeptide is studied for its biologica...
NPV Resource: Oligopeptide Research Reference
The NPV database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
NPY → Y1R: Oligopeptide Research Reference
NPY → Y1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NPY Anxiolysis: Neuropeptide in Neuroscience Reference
Anxiolytic effects of NPY through Y1 receptor activation in amygdala. This neuropeptide is involved in neurological signaling and is studied for its roles in...
NPY Central Effects: Neuropeptide in Neuroscience Reference
Central NPY effects on feeding, energy balance, and stress response. This neuropeptide is involved in neurological signaling and is studied for its roles in ...
NPY Hormone: Endogenous Peptide Hormone Reference
NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NPY Peptide Hormone: Endogenous Peptide Hormone Reference
NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NPY Protein Hormone: Endogenous Peptide Hormone Reference
NPY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
NRAS Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting NRAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
NT 3 Analog: Oligopeptide Research Reference
NT 3 analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
NT 3 Hormone: Endogenous Peptide Hormone Reference
NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT 3 Peptide Hormone: Endogenous Peptide Hormone Reference
NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT 3 Protein Hormone: Endogenous Peptide Hormone Reference
NT 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT 4 Hormone: Endogenous Peptide Hormone Reference
NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT 4 Peptide Hormone: Endogenous Peptide Hormone Reference
NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT 4 Protein Hormone: Endogenous Peptide Hormone Reference
NT 4, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
NT-proBNP (N-Terminal Pro-BNP)
Comprehensive reference for NT-proBNP (N-Terminal Pro-BNP), a peptide compound with applications in research and therapeutics.
NT-proBNP: Oligopeptide Research Reference
76-amino acid N-terminal fragment of proBNP. Biologically inactive but cleared by kidneys (t½ ~120 min). More stable than BNP. Normal: <125 pg/mL (<750 pg/mL...
NTRK Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting NTRK Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
Nuclear receptor: Oligopeptide Research Reference
Comprehensive reference for nuclear receptor, covering molecular structure, pharmacological properties, receptor interactions,
Nuclease Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Nuclease Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...
Nuclease PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Nuclease for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Nusinersen: Oligopeptide Research Reference
Nusinersen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
NVX-CoV2373: Oligopeptide Research Reference
NVX-CoV2373, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Nystatin (Fungicidin): Oligopeptide Research Reference
Nystatin (Fungicidin), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
O-Glycosylation of Peptides: Comprehensive Peptide Reference
Explore O-glycosylation on serine and threonine residues and its impact on peptide function. This modification affects peptide stability, receptor binding, a...
OaBac11: Oligopeptide Research Reference
OaBac11, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
OaBac5: Oligopeptide Research Reference
OaBac5, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
OaDodecapeptide: Oligopeptide Research Reference
OaDodecapeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Oats Peptide: Oligopeptide Research Reference
A bioactive peptide derived from oats with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Obesity and Peptides: Oligopeptide Research Reference
Explore peptide therapeutics targeting obesity including GLP-1/GIP dual agonists and appetite-regulating peptides. Covers molecular mechanisms, biological ac...
Obesity Peptides: Oligopeptide Research Reference
Peptides associated with Obesity including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Obesity Treatment: Oligopeptide Research Reference
Peptide therapeutics for obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Obesity: Oligopeptide Research Reference
Excess body fat (BMI ≥30). Multifactorial. Treatments: lifestyle, GLP-1 agonists (semaglutide, tirzepatide), bariatric surgery.
Obestatin Hormone: Endogenous Peptide Hormone Reference
Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Obestatin Peptide Hormone: Comprehensive Peptide Reference
Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Obestatin Protein Hormone: Comprehensive Peptide Reference
Obestatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Obestatin: Endogenous Peptide Hormone Reference
23-amino acid gastric peptide derived from the ghrelin precursor, initially proposed as an anorexigenic hormone. Covers molecular mechanisms, biological acti...
objective-response Resource: Comprehensive Peptide Reference
The objective-response database or resource for peptide research, providing data on structure, function, and interactions.
Octreotide - Acromegaly (NCT00000124)
Trial of octreotide for acromegaly treatment. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
Octreotide LAR: Oligopeptide Research Reference
Long-acting repeatable microsphere formulation of octreotide providing 28-day sustained somatostatin receptor agonism. Covers molecular mechanisms, biologica...
Octreotide: Oligopeptide Research Reference
octreotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Octreotide: Oligopeptide Research Reference
Long-acting somatostatin analog with D-Phe and Thr-ol for acromegaly and carcinoid tumors. This peptide or oligopeptide is studied for its biological activit...
octupole-moment Resource: Oligopeptide Research Reference
The octupole-moment database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...
Ocular Peptide Delivery: Oligopeptide Research Reference
Ophthalmic delivery systems for peptide drugs targeting anterior and posterior segment. This peptide or oligopeptide is studied for its biological activity, ...
Okadaic Acid: Oligopeptide Research Reference
Okadaic Acid, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Oliceridine Biased Agonist: Comprehensive Peptide Reference
G protein-biased mu-opioid agonist with potentially reduced side effects. This neuropeptide is involved in neurological signaling and is studied for its role...
Olipudase Alfa: Oligopeptide Research Reference
Olipudase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Omadacycline: Oligopeptide Research Reference
Omadacycline, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Omega Conotoxin SO3: Peptide Toxin in Pharmacology Reference
omega-conotoxin-SO3 is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biolo...
Omega-Conotoxin CVID: Peptide Toxin in Pharmacology Refer...
N-type calcium channel blocker from Conus catus with clinical development for pain. This peptide toxin is derived from venom and studied for its pharmacologi...
Omega-Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...
N-type calcium channel blocker from Conus geographus with high selectivity. This peptide toxin is derived from venom and studied for its pharmacological acti...
Omega-Conotoxin MVIIA: Peptide Toxin in Pharmacology Refe...
N-type calcium channel blocker from Conus magus for severe chronic pain. This peptide toxin is derived from venom and studied for its pharmacological activit...
Omega-Conotoxin: Peptide Toxin in Pharmacology Reference
Omega-conotoxins are disulfide-rich peptides from cone snail venom that block N-type and P/Q-type voltage-gated calcium channels, with ziconotide as the appr...
OmegaFold for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using OmegaFold. This analytical technique provides valuable insights into peptide structure, purity, and charac...
Omentin Hormone: Endogenous Peptide Hormone Reference
Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Omentin Peptide Hormone: Endogenous Peptide Hormone Refer...
Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Omentin Protein Hormone: Endogenous Peptide Hormone Refer...
Omentin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical si...
Omiganan: Antimicrobial Peptide Reference
Synthetic indolicidin-derived antimicrobial peptide under investigation for catheter-related infections and acne vulgaris.
Oncology / GnRH Agonist: Oligopeptide Research Reference
Oncology / GnRH Agonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolo...
Oncology / GnRH Antagonist (oral)
Oncology / GnRH Antagonist (oral) is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Oncology / Oral GnRH Antagonist
Oncology / Oral GnRH Antagonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Oncology / Proteasome Inhibitor
Oncology / Proteasome Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological activ...
Oncology: Oligopeptide Research Reference
Clinical trials for cancer. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
Oncology/Endocrine / GnRH Agonist
Oncology/Endocrine / GnRH Agonist is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological act...
Onion Peptide: Oligopeptide Research Reference
A bioactive peptide derived from onion with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
OpenFold for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using OpenFold. This analytical technique provides valuable insights into peptide structure, purity, and charact...
Ophidine: Oligopeptide Research Reference
ophidine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Opioid Cardiovascular Effects: Comprehensive Peptide Refe...
Effects of endogenous opioids on heart rate and blood pressure. This neuropeptide is involved in neurological signaling and is studied for its roles in brain...
Opioid Distribution Brain: Comprehensive Peptide Reference
Regional distribution of opioid peptides in brain and pain/reward roles. This neuropeptide is involved in neurological signaling and is studied for its roles...
Opioid Distribution Spinal: Comprehensive Peptide Reference
Distribution in dorsal horn and segmental pain modulation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...
Opioid Enteric Nervous System: Comprehensive Peptide Refe...
Opioid peptides in enteric and peripheral sensory neurons. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...
Opioid Feeding Regulation: Comprehensive Peptide Reference
Endogenous opioid regulation of feeding behavior and food reward. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...
Opioid Immune Effects: Neuropeptide in Neuroscience Refer...
Immunomodulatory effects of endogenous opioids on immune function. This neuropeptide is involved in neurological signaling and is studied for its roles in br...
Opioid Neuroendocrine: Neuropeptide in Neuroscience Refer...
Effects on hypothalamic-pituitary axes including cortisol and GH. This neuropeptide is involved in neurological signaling and is studied for its roles in bra...
Opioid Peptide Biosensors: Comprehensive Peptide Reference
Genetically encoded biosensors for real-time imaging of opioid peptide signaling. This neuropeptide is involved in neurological signaling and is studied for ...
Opioid Peptide Chemogenetics: Comprehensive Peptide Refer...
DREADD-based chemogenetic control of opioid peptide neurons. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fu...
Opioid Peptide Computational Modeling
Computational models of opioid peptide-receptor interactions. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...
Opioid Peptide Drug Design: Comprehensive Peptide Reference
Structure-based design of novel opioid peptides with improved properties. This neuropeptide is involved in neurological signaling and is studied for its role...
Opioid Peptide Family: Oligopeptide Research Reference
Overview of endorphins, enkephalins, and dynorphins in pain modulation and reward pathways. This peptide or oligopeptide is studied for its biological activi...
Opioid Peptide Mass Spectrometry
Mass spectrometric methods for identification and quantification of endogenous opioids. This neuropeptide is involved in neurological signaling and is studie...
Opioid Peptide Microdialysis: Comprehensive Peptide Refer...
In vivo microdialysis for measuring opioid peptide release in brain regions. This neuropeptide is involved in neurological signaling and is studied for its r...
Opioid Peptide Optogenetics: Comprehensive Peptide Reference
Optogenetic control of opioid peptide release from specific neuronal populations. This neuropeptide is involved in neurological signaling and is studied for ...
Opioid Peptide Overdose: Oligopeptide Research Reference
Excessive opioid peptide dosing. Can cause respiratory depression. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Opioid Peptide Radioligands: Comprehensive Peptide Reference
Radiolabeled opioid peptides for receptor imaging and binding studies. This neuropeptide is involved in neurological signaling and is studied for its roles i...
Opioid Precursor Processing: Comprehensive Peptide Reference
Enzymatic processing of POMC, proenkephalin, and prodynorphin. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Opioid Receptor Dimerization: Comprehensive Peptide Refer...
Mu-delta and mu-kappa receptor heterodimer formation affecting selectivity. This neuropeptide is involved in neurological signaling and is studied for its ro...
Opioid Receptor Knockout Studies
Behavioral phenotypes from opioid receptor gene knockout mice. This neuropeptide is involved in neurological signaling and is studied for its roles in brain ...
Opioid Receptor Polymorphisms: Comprehensive Peptide Refe...
Genetic variation affecting analgesic response and addiction susceptibility. This neuropeptide is involved in neurological signaling and is studied for its r...
Opioid Receptor Trafficking: Comprehensive Peptide Reference
Agonist-induced internalization, recycling, and degradation affecting tolerance. This neuropeptide is involved in neurological signaling and is studied for i...
Opioid Respiratory Control: Comprehensive Peptide Reference
Role of endogenous opioids in respiratory rhythm generation. This neuropeptide is involved in neurological signaling and is studied for its roles in brain fu...
Opioid Reward Circuitry: Neuropeptide in Neuroscience Ref...
Endogenous opioids in mesolimbic dopamine reward pathways. This neuropeptide is involved in neurological signaling and is studied for its roles in brain func...
Opioid Sexual Behavior: Neuropeptide in Neuroscience Refe...
Role of endogenous opioids in sexual arousal and orgasm. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functi...
Opioid Stress Analgesia: Neuropeptide in Neuroscience Ref...
Role of endogenous opioids in stress-induced analgesia. This neuropeptide is involved in neurological signaling and is studied for its roles in brain functio...
Opioid Tolerance Mechanisms: Comprehensive Peptide Reference
Cellular mechanisms of tolerance including desensitization and signaling adaptations. This neuropeptide is involved in neurological signaling and is studied ...
Opioid Withdrawal Peptides: Comprehensive Peptide Reference
Role of endogenous opioids in withdrawal including anti-opioid peptide systems. This neuropeptide is involved in neurological signaling and is studied for it...
Opioid-Induced Hyperalgesia: Comprehensive Peptide Reference
Paradoxical pain sensitization from chronic opioid use via NMDA pathways. This neuropeptide is involved in neurological signaling and is studied for its role...
Opioid-related peptide: Neuropeptide in Neuroscience Refe...
Opioid-related peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Oprelvekin: Oligopeptide Research Reference
Recombinant interleukin-11 for chemotherapy-induced thrombocytopenia, stimulating megakaryocyte proliferation. This peptide or oligopeptide is studied for it...
Oral Antimicrobial Peptides: Comprehensive Peptide Reference
Salivary antimicrobial peptides including histatins, defensins, and LL-37. This antimicrobial peptide demonstrates activity against pathogens and is studied ...
Oral delivery system: Oligopeptide Research Reference
Comprehensive reference for oral delivery system, covering molecular structure, pharmacological properties, receptor interactions,
Oral Delivery: Oligopeptide Research Reference
Delivering peptides orally despite GI degradation challenges. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...
Oral Insulin Formulation: Oligopeptide Research Reference
Oral insulin development including gastric acid protection, intestinal permeation, and hepatic targeting. This peptide or oligopeptide is studied for its bio...
Oral Peptide Delivery Systems: Comprehensive Peptide Refe...
Systems for oral peptide delivery including enzyme inhibitors and permeation enhancers. This peptide or oligopeptide is studied for its biological activity, ...
Oral Peptide Delivery: Oligopeptide Research Reference
Explore strategies and challenges for oral delivery of peptide drugs including permeation enhancers and enteric coatings.
Oral Semaglutide Development History
Development history and formulation science behind oral semaglutide including SNAC technology. This peptide or oligopeptide is studied for its biological act...
Oral Semaglutide Formulation: Comprehensive Peptide Refer...
Oral bioavailability enhancement of semaglutide using SNAC absorption enhancer technology for once-daily oral GLP-1 therapy.
Oral Semaglutide: Oligopeptide Research Reference
Oral semaglutide formulation using SNAC absorption enhancer for gastrointestinal peptide protection. This peptide or oligopeptide is studied for its biologic...
Oral System 1: Oligopeptide Research Reference
A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
Oral System 2: Oligopeptide Research Reference
A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
Oral System 3: Oligopeptide Research Reference
A oral-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
Oral Tirzepatide: Oligopeptide Research Reference
Oral formulation of dual GIP/GLP-1 agonist tirzepatide using SNAC absorption technology. This peptide or oligopeptide is studied for its biological activity,...
Orange Peptide: Oligopeptide Research Reference
A bioactive peptide derived from orange with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Orellanine: Oligopeptide Research Reference
Orellanine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Orexin → OX1R: Oligopeptide Research Reference
Orexin → OX1R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Orexin A (Hypocretin-1): Neuropeptide in Neuroscience Ref...
Orexin A (Hypocretin-1), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Orexin A: Neuropeptide in Neuroscience Reference
Hypothalamic neuropeptide promoting wakefulness and energy homeostasis. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Orexin B: Neuropeptide in Neuroscience Reference
Hypothalamic neuropeptide with wake-promoting activity acting through OX2 receptor. This neuropeptide is involved in neurological signaling and is studied fo...
Orexin: Neuropeptide in Neuroscience Reference
A family of hypothalamic neuropeptides (orexin-A/hypocretin-1 and orexin-B/hypocretin-2) that regulate wakefulness, appetite, and energy homeostasis, with de...
Orforglipron: Oligopeptide Research Reference
Orforglipron, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Organic Precipitation Purification
A purification technique for separating and isolating peptides using Organic Precipitation. This analytical technique provides valuable insights into peptide...
Oritavancin: Antimicrobial Peptide Reference
Lipoglycopeptide antibiotic with multiple mechanisms of action and 14-day half-life for single-dose treatment of gram-positive infections.
Orphin: Neuropeptide in Neuroscience Reference
orphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation. Covers molecular mechanisms, biologica...
OSE-2101: Oligopeptide Research Reference
OSE-2101, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
OSM Hormone: Endogenous Peptide Hormone Reference
OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
OSM Peptide Hormone: Endogenous Peptide Hormone Reference
OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
OSM Protein Hormone: Endogenous Peptide Hormone Reference
OSM, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
Osteocalcin 1-14: Peptide Fragment Reference
Comprehensive reference for osteocalcin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 1-20: Peptide Fragment Reference
Comprehensive reference for osteocalcin 1-20 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 1-30: Peptide Fragment Reference
Comprehensive reference for osteocalcin 1-30 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 1-40: Peptide Fragment Reference
Comprehensive reference for osteocalcin 1-40 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 1-49: Peptide Fragment Reference
Comprehensive reference for osteocalcin 1-49 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 15-49: Peptide Fragment Reference
Comprehensive reference for osteocalcin 15-49 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 25-49: Peptide Fragment Reference
Comprehensive reference for osteocalcin 25-49 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 35-49: Peptide Fragment Reference
Comprehensive reference for osteocalcin 35-49 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin 40-49: Peptide Fragment Reference
Comprehensive reference for osteocalcin 40-49 variant, covering molecular structure, pharmacological properties, receptor interactions,
Osteocalcin Hormone: Endogenous Peptide Hormone Reference
Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Osteocalcin Peptide Hormone: Comprehensive Peptide Reference
Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Osteocalcin Protein Hormone: Comprehensive Peptide Reference
Osteocalcin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Osteocalcin: Structure, Function, and Significance
Osteocalcin is a bone-derived hormone that regulates glucose metabolism, testosterone production, and brain function. Covers molecular mechanisms, biological...
Osteopontin peptide: Structure, Function, and Significance
RGDSV is an osteopontin-derived peptide involved in bone cell adhesion and remodeling through integrin signaling. Covers molecular mechanisms, biological act...
Osteoporosis and Peptides: Comprehensive Peptide Reference
Learn about peptide-based osteoporosis treatments including PTH analogs and calcitonin for bone density improvement. Covers molecular mechanisms, biological ...
Ostreocin D: Oligopeptide Research Reference
Ostreocin D, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ostrich Cathelicidin (SdCATH): Comprehensive Peptide Refe...
Comprehensive reference for Ostrich Cathelicidin (SdCATH), a peptide compound with applications in research and therapeutics.
Ostrich Cathelicidin: Oligopeptide Research Reference
Ostrich Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ostrich Defensin: Oligopeptide Research Reference
Ostrich Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ovarian Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Ovarian Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...
Ovarian Cancer: Oligopeptide Research Reference
Malignant transformation of ovarian epithelium. Most lethal gynecologic cancer. This peptide or oligopeptide is studied for its biological activity, structur...
overall-survival Resource: Comprehensive Peptide Reference
The overall-survival database or resource for peptide research, providing data on structure, function, and interactions.
Overdose: Oligopeptide Research Reference
Life-threatening emergencies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Ovine Antimicrobial: Oligopeptide Research Reference
Ovine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
OVX836: Oligopeptide Research Reference
OVX836, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
OX40 Agonist: Oligopeptide Research Reference
OX40 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Oxidation Cleavable Purification
A purification technique for separating and isolating peptides using Oxidation Cleavable. This analytical technique provides valuable insights into peptide s...
Oxidative Folding Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Oxidative Folding for producing peptides with specific properties. This analytical technique provides valuable insights into...
Oxidoreductase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Oxidoreductase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
Oxytocin → OXTR: Oligopeptide Research Reference
Oxytocin → OXTR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Oxytocin 1-5: Peptide Fragment Reference
Comprehensive reference for oxytocin 1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 1-6: Peptide Fragment Reference
Comprehensive reference for oxytocin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 1-7: Peptide Fragment Reference
Comprehensive reference for oxytocin 1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 1-8: Peptide Fragment Reference
Comprehensive reference for oxytocin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 1-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 2-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 2-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 3-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 3-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 4-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 4-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 5-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 5-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 6-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 6-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 7-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 7-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin 8-9: Peptide Fragment Reference
Comprehensive reference for oxytocin 8-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Oxytocin Family Peptides: Oligopeptide Research Reference
Explore oxytocin family peptides and their roles in social bonding, labor, and lactation. This peptide or oligopeptide is studied for its biological activity...
Oxytocin Hormone: Endogenous Peptide Hormone Reference
Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Oxytocin Intramolecular (Disulfide Bond)
Comprehensive reference for Oxytocin Intramolecular (Disulfide Bond), a peptide compound with applications in research and therapeutics.
Oxytocin Peptide Hormone: Endogenous Peptide Hormone Refe...
Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Oxytocin Protein Hormone: Endogenous Peptide Hormone Refe...
Oxytocin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Oxytocin Receptor Agonist: Comprehensive Peptide Reference
oxytocin receptor agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
Oxytocin Receptor Antagonists: Comprehensive Peptide Refe...
Pharmacological inhibition of oxytocin receptors using peptidic antagonists such as atosiban and barusiban for the management of preterm labor and uterine hy...
Oxytocin Social Bonding: Neuropeptide in Neuroscience Ref...
Central oxytocin effects on pair bonding, trust, and social recognition. This neuropeptide is involved in neurological signaling and is studied for its roles...
Oxytocin: Endogenous Peptide Hormone Reference
A 9-amino acid neuropeptide hormone produced in the hypothalamus and released from the posterior pituitary, mediating uterine contraction, milk ejection, soc...
Oxytocin: Oligopeptide Research Reference
oxytocin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
Oyster Defensin Cg-Defh1: Antimicrobial Peptide Reference
Hemocyte defensin from Pacific oyster with antibacterial activity. This antimicrobial peptide demonstrates activity against pathogens and is studied for its ...
P Aeruginosa Mdr Peptide: Oligopeptide Research Reference
A peptide associated with P Aeruginosa Mdr for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, str...
P Aeruginosa Peptide: Oligopeptide Research Reference
A peptide associated with P Aeruginosa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...
P Mirabilis Peptide: Oligopeptide Research Reference
A peptide associated with P Mirabilis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structur...
P53 Activator PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting P53 Activator for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
P53 Modulator: Oligopeptide Research Reference
p53 modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
p53 Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
p53 Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
p53 Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
p53 Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
p53 Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the p53 signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
P75NTR Antagonist: Oligopeptide Research Reference
p75NTR antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
PACAP Fragment: Oligopeptide Research Reference
PACAP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
PACAP Hormone: Endogenous Peptide Hormone Reference
PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
PACAP Peptide Hormone: Endogenous Peptide Hormone Reference
PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
PACAP Protein Hormone: Endogenous Peptide Hormone Reference
PACAP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
PACAP: Neuropeptide in Neuroscience Reference
Neuropeptide structurally related to VIP with widespread CNS and peripheral effects. This neuropeptide is involved in neurological signaling and is studied f...
PACAP: Neuropeptide in Neuroscience Reference
A 38-amino acid hypothalamic neuropeptide that activates adenylyl cyclase, regulating neurotransmission, neuroprotection, and cardiovascular function through...
PAFP-S: Oligopeptide Research Reference
PAFP-S, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pain and Peptides: Oligopeptide Research Reference
Discover neuropeptide-based analgesic approaches including opioid peptides and substance P antagonists. This peptide or oligopeptide is studied for its biolo...
Pain Management: Oligopeptide Research Reference
Peptide-based approaches to pain management. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Painless delivery: Oligopeptide Research Reference
ID. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research ...
Palicourein: Oligopeptide Research Reference
Palicourein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Palmitoyl Tetrapeptide-7 (Eyeseryl)
Comprehensive reference for Palmitoyl Tetrapeptide-7 (Eyeseryl), a peptide compound with applications in research and therapeutics.
Palmitoyl Tripeptide-1 (Matrixyl 3000)
Comprehensive reference for Palmitoyl Tripeptide-1 (Matrixyl 3000), a peptide compound with applications in research and therapeutics.
Palytoxin: Oligopeptide Research Reference
Palytoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pancreatic Cancer Peptides: Comprehensive Peptide Reference
Peptides associated with Pancreatic Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its...
Pancreatic Cancer: Oligopeptide Research Reference
Most lethal common cancer (5-year survival ~12%). KRAS mutations (90%). Usually diagnosed late. Treatments: FOLFIRINOX, gemcitabine/nab-paclitaxel, olaparib ...
Pancreatic Polypeptide Hormone
Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...
Pancreatic Polypeptide Peptide Hormone
Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...
Pancreatic Polypeptide Protein Hormone
Pancreatic Polypeptide, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, ...
Pancreatic Polypeptide: Oligopeptide Research Reference
Pancreatic Polypeptide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Paneth Cell Secretion: Antimicrobial Peptide Reference
Regulated exocytosis of defensin granules in response to microbial signals. This antimicrobial peptide demonstrates activity against pathogens and is studied...
Paramagnetic Labeling Synthesis
A peptide synthesis method using Paramagnetic Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolo...
Paramecium bursaria: Oligopeptide Research Reference
Released upon mechanical stimulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Parasin I: Oligopeptide Research Reference
Parasin I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Parathyroid Hormone Family Peptides
Overview of PTH family peptides including PTH and PTHrP in calcium homeostasis and bone metabolism. This peptide or oligopeptide is studied for its biologica...
Parathyroid Hormone: Oligopeptide Research Reference
parathyroid hormone in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Parathyroid Hormone: Oligopeptide Research Reference
PTH for osteoporosis (teriparatide). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Pardaxin: Antimicrobial Peptide Reference
pardaxin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...
Parkinson's and Peptides: Oligopeptide Research Reference
Understand peptide-based strategies for Parkinson's disease including neurotrophic factors and alpha-synuclein modulators.
Parkinson's Disease: Oligopeptide Research Reference
Parkinson's Disease, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Parkinsons Peptides: Oligopeptide Research Reference
Peptides associated with Parkinsons including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
PARP Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PARP Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
partial-charge Resource: Oligopeptide Research Reference
The partial-charge database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
partial-response Resource: Comprehensive Peptide Reference
The partial-response database or resource for peptide research, providing data on structure, function, and interactions.
Pasireotide LAR: Oligopeptide Research Reference
Long-acting pasireotide microspheres for monthly dosing in Cushing disease and acromegaly. This peptide or oligopeptide is studied for its biological activit...
Pasireotide Somatostatin Analog
Multi-receptor targeted somatostatin analog with high affinity for somatostatin receptor subtype 5 for Cushing's disease.
Pasireotide: Oligopeptide Research Reference
pasireotide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Pasireotide: Oligopeptide Research Reference
Somatostatin analog with high sst5 affinity for Cushing disease and acromegaly. This peptide or oligopeptide is studied for its biological activity, structur...
PCA for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using PCA. This analytical technique provides valuable insights into peptide structure, purity, and characteriza...
PcTx1: Peptide Toxin in Pharmacology Reference
PcTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...
PD 1 Blocker: Oligopeptide Research Reference
PD 1 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
PD L1 Blocker: Oligopeptide Research Reference
PD L1 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
PDB (Sequence): Oligopeptide Research Reference
Protein sequences from the Protein Data Bank. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
PDB (Structure): Oligopeptide Research Reference
3D structural data from the Protein Data Bank. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
PDB Resource: Oligopeptide Research Reference
The PDB database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
PDB: Oligopeptide Research Reference
Protein Data Bank. Repository of 3D structural data for proteins and nucleic acids. This peptide or oligopeptide is studied for its biological activity, stru...
PDGF Hormone: Endogenous Peptide Hormone Reference
PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
PDGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PDGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
PDGF Peptide Hormone: Endogenous Peptide Hormone Reference
PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
PDGF Protein Hormone: Endogenous Peptide Hormone Reference
PDGF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signi...
PDGFR Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PDGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
PDGFR Inhibitor: Oligopeptide Research Reference
PDGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Pea Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pea with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Peach Peptide: Oligopeptide Research Reference
A bioactive peptide derived from peach with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Peakless Basal Insulin Profiles
Pharmacokinetic concept of flat, peakless basal insulin action profiles achieved by ultra-long-acting insulin analogues.
Peanut Peptide: Oligopeptide Research Reference
A bioactive peptide derived from peanut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Pear Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pear with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Pecan Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pecan with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Pediatrics: Oligopeptide Research Reference
Special considerations for peptide drug use in pediatric patients. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Pegbelfermin: Oligopeptide Research Reference
Pegbelfermin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pegfilgrastim: Oligopeptide Research Reference
pegfilgrastim in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Pegfilgrastim: Oligopeptide Research Reference
PEGylated filgrastim with extended half-life for single-dose chemotherapy-induced neutropenia prevention. This peptide or oligopeptide is studied for its bio...
Peginterferon Alfa: Oligopeptide Research Reference
PEGylated interferon alfa with extended half-life for weekly dosing in hepatitis B, hepatitis C, and cancer treatment. Covers molecular mechanisms, biologica...
PEGylated Insulin Analogues: Comprehensive Peptide Reference
Polyethylene glycol conjugation of insulin for half-life extension through increased hydrodynamic radius. This peptide or oligopeptide is studied for its bio...
PEGylated Insulin Lispro: Oligopeptide Research Reference
PEGylated rapid-acting insulin analog with extended duration providing both prandial and basal coverage. This peptide or oligopeptide is studied for its biol...
PEGylated Liposome Peptide: Comprehensive Peptide Reference
PEG-coated liposomes for extended circulation time and peptide drug targeting. This peptide or oligopeptide is studied for its biological activity, structure...
PEGylation strategy: Oligopeptide Research Reference
Comprehensive reference for pegylation strategy, covering molecular structure, pharmacological properties, receptor interactions,
PEGylation Synthesis: Analytical Technique in Peptide Res...
A peptide synthesis method using PEGylation for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...
PEGylation System 1: Oligopeptide Research Reference
A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
PEGylation System 2: Oligopeptide Research Reference
A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
PEGylation System 3: Oligopeptide Research Reference
A PEGylation-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges...
Pellenotoxin: Peptide Toxin in Pharmacology Reference
pellenotoxin is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for it...
Pembrolizumab: Oligopeptide Research Reference
pembrolizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Pemvidutide: Oligopeptide Research Reference
Dual GLP-1/glucagon receptor agonist using MOMA technology for balanced receptor activation. This peptide or oligopeptide is studied for its biological activ...
Penetratin: Oligopeptide Research Reference
Penetratin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Penicillium chrysogenum: Oligopeptide Research Reference
Binds chitin in fungal cell wall. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Pentosan Polysulfate: Oligopeptide Research Reference
Semi-synthetic glycosaminoglycan for interstitial cystitis bladder pain syndrome. This peptide or oligopeptide is studied for its biological activity, struct...
Pepper Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pepper with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peptide → BCR (Immune Recognition)
Comprehensive reference for Peptide → BCR (Immune Recognition), a peptide compound with applications in research and therapeutics.
Peptide → MHC Class I (Antigen Presentation)
Comprehensive reference for Peptide → MHC Class I (Antigen Presentation), a peptide compound with applications in research and therapeutics.
Peptide → MHC Class II (Antigen Presentation)
Comprehensive reference for Peptide → MHC Class II (Antigen Presentation), a peptide compound with applications in research and therapeutics.
Peptide → TCR (Immune Recognition)
Comprehensive reference for Peptide → TCR (Immune Recognition), a peptide compound with applications in research and therapeutics.
Peptide 3D Printed Devices: Comprehensive Peptide Reference
3D-printed devices for personalized peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Peptide 3D Printing: Oligopeptide Research Reference
Integration of bioactive peptides into 3D-printed scaffolds for tissue engineering and regenerative medicine applications.
Peptide acetylation analysis: Comprehensive Peptide Refer...
Comprehensive reference for peptide acetylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Acetylation Sites: Comprehensive Peptide Reference
Comprehensive overview of N-terminal and lysine acetylation and its role in peptide stability, functional modulation, and pharmacokinetic optimization in the...
Peptide adsorption: Oligopeptide Research Reference
Comprehensive reference for peptide adsorption, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Aggregation in Biologics
Amyloid formation and non-native peptide aggregation compromise biologics stability, requiring advanced analytical methods and formulation strategies to main...
Peptide aggregation: Oligopeptide Research Reference
Comprehensive reference for peptide aggregation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Albumin Binding: Oligopeptide Research Reference
Albumin-binding strategies for extending peptide circulating half-life. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peptide Analgesics: Oligopeptide Research Reference
Explore peptide-based pain therapeutics targeting opioid, nociceptin, and CGRP pathways. This peptide or oligopeptide is studied for its biological activity,...
Peptide Analytical Method Development
Developing and validating analytical methods for peptide characterization and quality control. This peptide or oligopeptide is studied for its biological act...
Peptide and Protein Engineering
Journal focused on peptide and protein engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
Peptide Anti-Inflammatory Agents
Guide to anti-inflammatory peptides modulating cytokines and immune cell recruitment. This peptide or oligopeptide is studied for its biological activity, st...
Peptide Antibiotics: Oligopeptide Research Reference
Explore antimicrobial peptides as next-generation antibiotics against drug-resistant bacteria. This peptide or oligopeptide is studied for its biological act...
Peptide Anticancer Agents: Comprehensive Peptide Reference
Learn about peptide-based anticancer strategies including targeted delivery and apoptosis induction. This peptide or oligopeptide is studied for its biologic...
Peptide Antifungals: Oligopeptide Research Reference
Guide to antifungal peptides targeting fungal membranes for treatment of invasive mycoses. This peptide or oligopeptide is studied for its biological activit...
Peptide Antivirals: Oligopeptide Research Reference
Overview of antiviral peptides disrupting viral entry, fusion, and replication processes. This peptide or oligopeptide is studied for its biological activity...
Peptide aptamer: Oligopeptide Research Reference
Comprehensive reference for peptide aptamer, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Article ${i}: Oligopeptide Research Reference
Biologically active peptide with therapeutic applications in medicine and research. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Autoimmune Therapeutics
Therapeutic peptides for autoimmune disease treatment including tolerogenic peptides and immunomodulatory agents. Covers molecular mechanisms, biological act...
Peptide Backbone 1: Oligopeptide Research Reference
Backbone conformation 1 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 10: Oligopeptide Research Reference
Backbone conformation 10 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 11: Oligopeptide Research Reference
Backbone conformation 11 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 12: Oligopeptide Research Reference
Backbone conformation 12 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 13: Oligopeptide Research Reference
Backbone conformation 13 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 14: Oligopeptide Research Reference
Backbone conformation 14 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 15: Oligopeptide Research Reference
Backbone conformation 15 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 16: Oligopeptide Research Reference
Backbone conformation 16 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 17: Oligopeptide Research Reference
Backbone conformation 17 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 18: Oligopeptide Research Reference
Backbone conformation 18 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 19: Oligopeptide Research Reference
Backbone conformation 19 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 2: Oligopeptide Research Reference
Backbone conformation 2 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 20: Oligopeptide Research Reference
Backbone conformation 20 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 21: Oligopeptide Research Reference
Backbone conformation 21 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 22: Oligopeptide Research Reference
Backbone conformation 22 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 23: Oligopeptide Research Reference
Backbone conformation 23 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 24: Oligopeptide Research Reference
Backbone conformation 24 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 25: Oligopeptide Research Reference
Backbone conformation 25 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 26: Oligopeptide Research Reference
Backbone conformation 26 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 27: Oligopeptide Research Reference
Backbone conformation 27 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 28: Oligopeptide Research Reference
Backbone conformation 28 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 29: Oligopeptide Research Reference
Backbone conformation 29 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 3: Oligopeptide Research Reference
Backbone conformation 3 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 30: Oligopeptide Research Reference
Backbone conformation 30 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 31: Oligopeptide Research Reference
Backbone conformation 31 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 32: Oligopeptide Research Reference
Backbone conformation 32 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 33: Oligopeptide Research Reference
Backbone conformation 33 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 34: Oligopeptide Research Reference
Backbone conformation 34 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 35: Oligopeptide Research Reference
Backbone conformation 35 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 36: Oligopeptide Research Reference
Backbone conformation 36 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 37: Oligopeptide Research Reference
Backbone conformation 37 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 38: Oligopeptide Research Reference
Backbone conformation 38 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 39: Oligopeptide Research Reference
Backbone conformation 39 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 4: Oligopeptide Research Reference
Backbone conformation 4 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 40: Oligopeptide Research Reference
Backbone conformation 40 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 41: Oligopeptide Research Reference
Backbone conformation 41 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 42: Oligopeptide Research Reference
Backbone conformation 42 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 43: Oligopeptide Research Reference
Backbone conformation 43 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 44: Oligopeptide Research Reference
Backbone conformation 44 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 45: Oligopeptide Research Reference
Backbone conformation 45 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 46: Oligopeptide Research Reference
Backbone conformation 46 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 47: Oligopeptide Research Reference
Backbone conformation 47 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 48: Oligopeptide Research Reference
Backbone conformation 48 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 49: Oligopeptide Research Reference
Backbone conformation 49 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 5: Oligopeptide Research Reference
Backbone conformation 5 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 50: Oligopeptide Research Reference
Backbone conformation 50 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Backbone 6: Oligopeptide Research Reference
Backbone conformation 6 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 7: Oligopeptide Research Reference
Backbone conformation 7 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 8: Oligopeptide Research Reference
Backbone conformation 8 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Backbone 9: Oligopeptide Research Reference
Backbone conformation 9 with specific phi/psi angles in protein structure. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide backbone modification: Comprehensive Peptide Refe...
Comprehensive reference for peptide backbone modification, covering molecular structure, pharmacological properties, receptor interactions,
Peptide bioconjugation: Oligopeptide Research Reference
Comprehensive reference for peptide bioconjugation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Biomarker Diagnostics: Comprehensive Peptide Refe...
Use of peptides and peptide fragments as diagnostic biomarkers in clinical laboratory testing and disease monitoring. Covers molecular mechanisms, biological...
Peptide Biomarkers: Oligopeptide Research Reference
Peptides as diagnostic and prognostic biomarkers for disease detection and monitoring. This peptide or oligopeptide is studied for its biological activity, s...
Peptide Biosimilar Delivery: Comprehensive Peptide Reference
Delivery considerations for biosimilar peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Peptide Biosimilar Development
Regulatory and scientific considerations for developing biosimilar peptide therapeutics. This peptide or oligopeptide is studied for its biological activity,...
Peptide Biosimilar Regulation: Comprehensive Peptide Refe...
Navigate regulatory pathways for peptide biosimilars including comparative analytical and clinical studies. This peptide or oligopeptide is studied for its b...
Peptide Biosimilars: Oligopeptide Research Reference
Biosimilar development for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
Peptide biotinylation: Oligopeptide Research Reference
Comprehensive reference for peptide biotinylation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Blood-Brain Barrier: Comprehensive Peptide Reference
Strategies for delivering peptides across the blood-brain barrier. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Peptide bond theory (1902), Fischer's amino acid research
Peptide bond theory (1902), Fischer's amino acid research is a bioactive compound with applications in peptide research and therapeutics.
Peptide C-terminal modification
Comprehensive reference for peptide c-terminal modification, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Cancer Market: Oligopeptide Research Reference
Market analysis for peptide-based cancer therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships,...
Peptide carbonylation analysis
Comprehensive reference for peptide carbonylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Cardiovascular Therapeutics
Therapeutic peptides targeting cardiovascular diseases including natriuretic peptides, ACE inhibitors, and anticoagulants.
Peptide Career Paths: Oligopeptide Research Reference
Career opportunities and professional paths in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, struct...
Peptide CDMO Industry: Oligopeptide Research Reference
Contract development and manufacturing organizations specializing in peptide production. This peptide or oligopeptide is studied for its biological activity,...
Peptide Chemistry and Drug Design
Resource on peptide chemistry principles and drug design applications. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Peptide citrullination analysis
Comprehensive reference for peptide citrullination analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Class: Oligopeptide Research Reference
Clinical Significance. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Peptide cleavage: Oligopeptide Research Reference
Comprehensive reference for peptide cleavage, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Clinical Trial Design: Comprehensive Peptide Refe...
Design considerations for clinical trials of peptide therapeutics including dosing, endpoints, and safety monitoring. Covers molecular mechanisms, biological...
Peptide Clinical Trials: Oligopeptide Research Reference
Clinical trial phases for peptide drugs: Phase I (safety, dosing, PK), Phase II (efficacy, dose-finding), Phase III (confirmatory, large-scale), Phase IV (po...
Peptide clipping: Oligopeptide Research Reference
Comprehensive reference for peptide clipping, covering molecular structure, pharmacological properties, receptor interactions,
Peptide coil assembly: Oligopeptide Research Reference
Comprehensive reference for peptide coil assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Combination Delivery: Comprehensive Peptide Refer...
Co-delivery systems for multiple peptide drugs in single formulation. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Peptide Companies Overview: Comprehensive Peptide Reference
Major pharmaceutical and biotechnology companies developing peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, struct...
Peptide Conference Calendar: Comprehensive Peptide Reference
Major conferences and events in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Peptide Conjugation Synthesis: Comprehensive Peptide Refe...
A peptide synthesis method using Peptide Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...
Peptide Controlled Release: Comprehensive Peptide Reference
Controlled release technologies for maintaining therapeutic peptide levels. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Cosmeceuticals: Oligopeptide Research Reference
Bioactive peptides used in cosmetic and skincare products for anti-aging, skin brightening, and wound healing applications.
Peptide Crop Protection: Oligopeptide Research Reference
Use of antimicrobial and insecticidal peptides as biopesticides and crop protection agents in agriculture. This peptide or oligopeptide is studied for its bi...
Peptide cryo-EM: Oligopeptide Research Reference
Comprehensive reference for peptide cryo-em, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Crystallization Techniques
Guide to peptide crystallization methods including hanging drop, sitting drop, and microbatch approaches. This peptide or oligopeptide is studied for its bio...
Peptide crystallization: Oligopeptide Research Reference
Comprehensive reference for peptide crystallization, covering molecular structure, pharmacological properties, receptor interactions,
Peptide cyclization: Oligopeptide Research Reference
Comprehensive reference for peptide cyclization, covering molecular structure, pharmacological properties, receptor interactions,
Peptide deamidation analysis: Comprehensive Peptide Refer...
Comprehensive reference for peptide deamidation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide degradation: Oligopeptide Research Reference
Comprehensive reference for peptide degradation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Dendrimer Conjugates: Comprehensive Peptide Refer...
Dendrimer conjugation for multivalent peptide display and delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Peptide Dermatological Drug Development
Development challenges for topical peptide therapeutics including skin penetration optimization. This peptide or oligopeptide is studied for its biological a...
Peptide Dermatological Therapeutics
Therapeutic peptides for skin conditions including wound healing, anti-scarring, and anti-inflammatory treatments. Covers molecular mechanisms, biological ac...
Peptide desorption: Oligopeptide Research Reference
Comprehensive reference for peptide desorption, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-1
Comprehensive reference for peptide diagnostic marker diagnostic-marker-1, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-10
Comprehensive reference for peptide diagnostic marker diagnostic-marker-10, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-11
Comprehensive reference for peptide diagnostic marker diagnostic-marker-11, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-12
Comprehensive reference for peptide diagnostic marker diagnostic-marker-12, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-13
Comprehensive reference for peptide diagnostic marker diagnostic-marker-13, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-14
Comprehensive reference for peptide diagnostic marker diagnostic-marker-14, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-15
Comprehensive reference for peptide diagnostic marker diagnostic-marker-15, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-16
Comprehensive reference for peptide diagnostic marker diagnostic-marker-16, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-17
Comprehensive reference for peptide diagnostic marker diagnostic-marker-17, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-18
Comprehensive reference for peptide diagnostic marker diagnostic-marker-18, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-19
Comprehensive reference for peptide diagnostic marker diagnostic-marker-19, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-2
Comprehensive reference for peptide diagnostic marker diagnostic-marker-2, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-20
Comprehensive reference for peptide diagnostic marker diagnostic-marker-20, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-21
Comprehensive reference for peptide diagnostic marker diagnostic-marker-21, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-22
Comprehensive reference for peptide diagnostic marker diagnostic-marker-22, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-23
Comprehensive reference for peptide diagnostic marker diagnostic-marker-23, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-24
Comprehensive reference for peptide diagnostic marker diagnostic-marker-24, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-25
Comprehensive reference for peptide diagnostic marker diagnostic-marker-25, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-26
Comprehensive reference for peptide diagnostic marker diagnostic-marker-26, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-27
Comprehensive reference for peptide diagnostic marker diagnostic-marker-27, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-28
Comprehensive reference for peptide diagnostic marker diagnostic-marker-28, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-29
Comprehensive reference for peptide diagnostic marker diagnostic-marker-29, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-3
Comprehensive reference for peptide diagnostic marker diagnostic-marker-3, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-30
Comprehensive reference for peptide diagnostic marker diagnostic-marker-30, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-31
Comprehensive reference for peptide diagnostic marker diagnostic-marker-31, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-32
Comprehensive reference for peptide diagnostic marker diagnostic-marker-32, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-33
Comprehensive reference for peptide diagnostic marker diagnostic-marker-33, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-34
Comprehensive reference for peptide diagnostic marker diagnostic-marker-34, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-35
Comprehensive reference for peptide diagnostic marker diagnostic-marker-35, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-36
Comprehensive reference for peptide diagnostic marker diagnostic-marker-36, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-37
Comprehensive reference for peptide diagnostic marker diagnostic-marker-37, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-38
Comprehensive reference for peptide diagnostic marker diagnostic-marker-38, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-39
Comprehensive reference for peptide diagnostic marker diagnostic-marker-39, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-4
Comprehensive reference for peptide diagnostic marker diagnostic-marker-4, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-40
Comprehensive reference for peptide diagnostic marker diagnostic-marker-40, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-5
Comprehensive reference for peptide diagnostic marker diagnostic-marker-5, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-6
Comprehensive reference for peptide diagnostic marker diagnostic-marker-6, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-7
Comprehensive reference for peptide diagnostic marker diagnostic-marker-7, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-8
Comprehensive reference for peptide diagnostic marker diagnostic-marker-8, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostic Marker diagnostic-marker-9
Comprehensive reference for peptide diagnostic marker diagnostic-marker-9, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Diagnostics Future: Comprehensive Peptide Reference
Emerging peptide-based diagnostic technologies for next-generation clinical testing. This peptide or oligopeptide is studied for its biological activity, str...
Peptide Diagnostics: Oligopeptide Research Reference
Explore peptide-based diagnostic tools for biomarker detection and disease monitoring. This peptide or oligopeptide is studied for its biological activity, s...
Peptide diffraction: Oligopeptide Research Reference
Comprehensive reference for peptide diffraction, covering molecular structure, pharmacological properties, receptor interactions,
Peptide disordered: Oligopeptide Research Reference
Comprehensive reference for peptide disordered, covering molecular structure, pharmacological properties, receptor interactions,
Peptide DMFs and IMPs: Oligopeptide Research Reference
Understand Drug Master File and Investigational Medicinal Product dossier requirements for peptide APIs. This peptide or oligopeptide is studied for its biol...
Peptide Drug 505(b)(2) Development
Development pathway for modified peptide drug products using the FDA 505(b)(2) regulatory pathway. This peptide or oligopeptide is studied for its biological...
Peptide Drug Cleaning Validation
Validation of cleaning procedures for peptide manufacturing equipment to prevent cross-contamination. This peptide or oligopeptide is studied for its biologi...
Peptide Drug Comparability Studies
Requirements for demonstrating comparability of peptide drug products after manufacturing changes. This peptide or oligopeptide is studied for its biological...
Peptide Drug Conjugates: Oligopeptide Research Reference
An overview of peptide-drug conjugates as targeted therapeutics, covering linker chemistry, payload selection, and mechanisms of intracellular drug release.
Peptide Drug Connected Devices
Integration of digital technology with peptide drug delivery devices for monitoring and adherence. This peptide or oligopeptide is studied for its biological...
Peptide Drug Container Closure Systems
Selection and qualification of container closure systems for peptide drug products. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide Drug Continuous Manufacturing
Transition from batch to continuous manufacturing for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Peptide Drug Delivery Future: Comprehensive Peptide Refer...
Next-generation delivery technologies for peptide therapeutics beyond traditional injections. This peptide or oligopeptide is studied for its biological acti...
Peptide Drug Device Development
Development of drug-device combination products including autoinjectors and pen injectors. This peptide or oligopeptide is studied for its biological activit...
Peptide Drug Digital Twins: Comprehensive Peptide Reference
Digital twin technology for peptide drug development and manufacturing processes. This peptide or oligopeptide is studied for its biological activity, struct...
Peptide Drug Excipient Compatibility
Studies assessing the compatibility of peptide active ingredients with pharmaceutical excipients. This peptide or oligopeptide is studied for its biological ...
Peptide Drug Future Perspectives
Emerging trends and future directions in peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Peptide Drug Pricing: Oligopeptide Research Reference
Factors influencing the pricing of peptide therapeutics and market dynamics. This peptide or oligopeptide is studied for its biological activity, structure-a...
Peptide Drug Reprocessing: Comprehensive Peptide Reference
Procedures and controls for reprocessing and reworking peptide drug products during manufacturing. This peptide or oligopeptide is studied for its biological...
Peptide Drug Stability-Indicating Methods
Development and validation of analytical methods that detect changes in peptide drug quality over time. This peptide or oligopeptide is studied for its biolo...
Peptide Drug Sustainability: Comprehensive Peptide Reference
Environmental and social sustainability in peptide drug manufacturing, packaging, and distribution. This peptide or oligopeptide is studied for its biologica...
Peptide E: Neuropeptide in Neuroscience Reference
peptide-E is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Peptide embedding: Oligopeptide Research Reference
Comprehensive reference for peptide embedding, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Encapsulation Efficiency
Methods for measuring and optimizing peptide encapsulation in delivery systems. This peptide or oligopeptide is studied for its biological activity, structur...
Peptide encapsulation: Oligopeptide Research Reference
Comprehensive reference for peptide encapsulation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Endocrine Therapeutics
Therapeutic peptides for endocrine disorders including diabetes, thyroid disease, and adrenal insufficiency. This peptide or oligopeptide is studied for its ...
Peptide entrapment: Oligopeptide Research Reference
Comprehensive reference for peptide entrapment, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Environmental Remediation
Use of metal-binding and biosurfactant peptides for heavy metal remediation and environmental cleanup applications. Covers molecular mechanisms, biological a...
Peptide Excipient Qualification
Understand excipient selection and qualification requirements for peptide drug product formulation. This peptide or oligopeptide is studied for its biologica...
Peptide F: Neuropeptide in Neuroscience Reference
peptide-F is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Peptide Fc Fusion Technology: Comprehensive Peptide Refer...
Fc fusion protein technology for extending peptide drug half-life. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Peptide fiber assembly: Oligopeptide Research Reference
Comprehensive reference for peptide fiber assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide fibril: Oligopeptide Research Reference
Comprehensive reference for peptide fibril, covering molecular structure, pharmacological properties, receptor interactions,
Peptide fluorescent labeling: Comprehensive Peptide Refer...
Comprehensive reference for peptide fluorescent labeling, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Food Supplements: Oligopeptide Research Reference
Bioactive peptides used in nutritional supplements for muscle recovery, joint health, and metabolic support. This peptide or oligopeptide is studied for its ...
Peptide formulation: Oligopeptide Research Reference
Comprehensive reference for peptide formulation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide freeze-drying: Oligopeptide Research Reference
Comprehensive reference for peptide freeze-drying, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Gastrointestinal Therapeutics
Therapeutic peptides for GI conditions including IBD, IBS, and motility disorders. This peptide or oligopeptide is studied for its biological activity, struc...
Peptide Gene Delivery: Oligopeptide Research Reference
Peptide vectors for nucleic acid delivery in gene therapy. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Peptide Gene Therapy: Oligopeptide Research Reference
Peptides as delivery vehicles and modulators in gene therapy applications. This peptide or oligopeptide is studied for its biological activity, structure-act...
Peptide Generic Market: Oligopeptide Research Reference
The landscape of generic and biosimilar peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...
Peptide glass transition: Oligopeptide Research Reference
Comprehensive reference for peptide glass transition, covering molecular structure, pharmacological properties, receptor interactions,
Peptide glycosylation analysis
Comprehensive reference for peptide glycosylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide glypiation: Oligopeptide Research Reference
Comprehensive reference for peptide glypiation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Health Economics: Oligopeptide Research Reference
Health economic evaluation of peptide therapeutics including cost-effectiveness and market access. This peptide or oligopeptide is studied for its biological...
Peptide helix assembly: Oligopeptide Research Reference
Comprehensive reference for peptide helix assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Hematological Therapeutics
Therapeutic peptides for blood disorders including anemia, thrombocytopenia, and coagulopathies. This peptide or oligopeptide is studied for its biological a...
Peptide Hepatic Therapeutics: Comprehensive Peptide Refer...
Therapeutic peptides for liver diseases including hepatitis, cirrhosis, and metabolic liver conditions. This peptide or oligopeptide is studied for its biolo...
Peptide Hormone Replacement Therapy
Clinical use of peptide hormones for replacement therapy in endocrine deficiency disorders. This endogenous peptide hormone plays important roles in physiolo...
Peptide hydrocarbon stapling: Comprehensive Peptide Refer...
Comprehensive reference for peptide hydrocarbon stapling, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Hydrogel Network: Oligopeptide Research Reference
Engineering hydrogel networks for controlled peptide release kinetics. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Peptide hydrogel self-assembly
Comprehensive reference for peptide hydrogel self-assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Hydrogels: Oligopeptide Research Reference
A review of self-assembling peptide hydrogels including RADA16 and EAK16, covering self-assembly mechanisms, mechanical properties, and tissue engineering ap...
Peptide hydrolysis: Oligopeptide Research Reference
Comprehensive reference for peptide hydrolysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Imaging Agents: Oligopeptide Research Reference
Guide to radiolabeled peptides as imaging agents in PET, SPECT, and fluorescence imaging. This peptide or oligopeptide is studied for its biological activity...
Peptide immobilization: Oligopeptide Research Reference
Comprehensive reference for peptide immobilization, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Immunomodulators: Oligopeptide Research Reference
Overview of immunomodulatory peptides enhancing or suppressing immune responses therapeutically. This peptide or oligopeptide is studied for its biological a...
Peptide Immunotherapy: Oligopeptide Research Reference
Peptide-based approaches to modulate immune responses in cancer and autoimmune diseases. This peptide or oligopeptide is studied for its biological activity,...
Peptide Implant Device: Oligopeptide Research Reference
Non-biodegradable implant devices for year-long peptide drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Peptide Industry Partnerships: Comprehensive Peptide Refe...
Strategic partnerships and collaborations in the peptide therapeutics industry. This peptide or oligopeptide is studied for its biological activity, structur...
Peptide Infectious Disease Therapeutics
Therapeutic peptides for infectious diseases including antivirals, antifungals, and antiparasitic agents. This peptide or oligopeptide is studied for its bio...
Peptide Inhaler Devices: Oligopeptide Research Reference
Guide to dry powder inhaler and metered-dose devices optimized for pulmonary peptide delivery. This peptide or oligopeptide is studied for its biological act...
Peptide Intellectual Property Strategy
Strategic approaches to protecting peptide innovations through patents and trade secrets. This peptide or oligopeptide is studied for its biological activity...
Peptide intrinsically disordered
Comprehensive reference for peptide intrinsically disordered, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Investment: Oligopeptide Research Reference
Venture capital, M&A, and public market investment trends in peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, struc...
Peptide isomerization analysis
Comprehensive reference for peptide isomerization analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide isostere: Oligopeptide Research Reference
Comprehensive reference for peptide isostere, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Labeling Requirements: Comprehensive Peptide Refe...
Learn regulatory requirements for peptide drug labeling including package inserts and prescribing information. This peptide or oligopeptide is studied for it...
Peptide labeling: Oligopeptide Research Reference
Comprehensive reference for peptide labeling, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Libraries: Oligopeptide Research Reference
Collections of diverse peptides for screening and drug discovery. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Peptide Lipid Conjugates: Oligopeptide Research Reference
Lipid conjugation for membrane anchoring and sustained peptide release. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peptide lipidation: Oligopeptide Research Reference
Comprehensive reference for peptide lipidation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide loop assembly: Oligopeptide Research Reference
Comprehensive reference for peptide loop assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Lyophilization: Oligopeptide Research Reference
Lyophilization protocols for stabilizing peptide drugs in solid form. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Peptide Manufacturing Scale-Up
Challenges and solutions for scaling peptide synthesis from laboratory to commercial manufacturing. This peptide or oligopeptide is studied for its biologica...
Peptide Manufacturing: Oligopeptide Research Reference
Manufacturing methods: SPPS (Fmoc strategy, most common), liquid-phase synthesis (large-scale), recombinant production (E. coli, yeast, mammalian cells), enz...
Peptide Mapping: Analytical Technique in Peptide Research
Learn peptide mapping strategies for characterizing protein primary structure and identifying post-translational modifications.
Peptide Market Access Strategies
Pricing, reimbursement, and market access strategies for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structure...
Peptide Market Size: Oligopeptide Research Reference
Current global peptide therapeutics market size and growth projections. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peptide Market Trends: Oligopeptide Research Reference
Market trends in peptide therapeutics including growth drivers and opportunities. This peptide or oligopeptide is studied for its biological activity, struct...
Peptide mass spectrometry: Comprehensive Peptide Reference
Comprehensive reference for peptide mass spectrometry, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Metabolism in the Liver
An examination of hepatic peptide metabolism including extraction mechanisms, cytochrome P450 involvement, peptidase activity, and implications for first-pas...
Peptide methylation analysis: Comprehensive Peptide Refer...
Comprehensive reference for peptide methylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Methylation Sites: Comprehensive Peptide Reference
Learn about arginine and lysine methylation in peptide epigenetic regulation. This modification affects peptide stability, receptor binding, and biological a...
Peptide micelle assembly: Oligopeptide Research Reference
Comprehensive reference for peptide micelle assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Microarrays: Analytical Technique in Peptide Rese...
Learn about high-throughput peptide microarray platforms for screening binding interactions and enzyme substrates. Covers molecular mechanisms, biological ac...
Peptide Microchip Devices: Comprehensive Peptide Reference
Microchip-controlled devices for programmable peptide delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
Peptide Microneedle Patches: Comprehensive Peptide Reference
Transdermal microneedle patch technology for painless peptide delivery through the stratum corneum barrier. This peptide or oligopeptide is studied for its b...
Peptide Microsphere Depot: Comprehensive Peptide Reference
Biodegradable microspheres forming sustained-release depots for peptide drugs. This peptide or oligopeptide is studied for its biological activity, structure...
Peptide mimetic: Oligopeptide Research Reference
Comprehensive reference for peptide mimetic, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Mimetics: Post-Translational Modification Reference
Guide to peptide mimetics that replicate natural peptide functions with enhanced properties. This modification affects peptide stability, receptor binding, a...
Peptide misfolding: Oligopeptide Research Reference
Comprehensive reference for peptide misfolding, covering molecular structure, pharmacological properties, receptor interactions,
Peptide modification analysis: Comprehensive Peptide Refe...
Comprehensive reference for peptide modification analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Molecular Docking: Comprehensive Peptide Reference
Computational methods for predicting peptide-receptor binding poses and affinities in drug design and optimization. Covers molecular mechanisms, biological a...
Peptide molten globule: Oligopeptide Research Reference
Comprehensive reference for peptide molten globule, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Musculoskeletal Therapeutics
Therapeutic peptides for bone, joint, and muscle conditions including osteoporosis and sarcopenia. This peptide or oligopeptide is studied for its biological...
Peptide Myristoylation Sites: Comprehensive Peptide Refer...
Explore N-myristoylation in peptide membrane association and protein interactions. This modification affects peptide stability, receptor binding, and biologi...
Peptide myristoylation: Oligopeptide Research Reference
Comprehensive reference for peptide myristoylation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide N-terminal modification
Comprehensive reference for peptide n-terminal modification, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Nanofiber Delivery: Comprehensive Peptide Reference
Self-assembling peptide nanofibers for localized drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
Peptide Nanomedicine: Oligopeptide Research Reference
Peptide Nanomedicine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Peptide nanoparticle self-assembly
Comprehensive reference for peptide nanoparticle self-assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Nanotechnology: Oligopeptide Research Reference
Self-assembling peptides and nanostructures for biomedical and materials applications. This peptide or oligopeptide is studied for its biological activity, s...
Peptide NDA Submission: Oligopeptide Research Reference
Guide to compiling a complete New Drug Application for peptide therapeutics including CMC and clinical sections. Covers molecular mechanisms, biological acti...
Peptide Neurological Therapeutics
Therapeutic peptides targeting neurological conditions including pain, neurodegenerative diseases, and psychiatric disorders.
Peptide nitrosylation analysis
Comprehensive reference for peptide nitrosylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide NMR: Oligopeptide Research Reference
Comprehensive reference for peptide nmr, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Nucleic Acid Detection
Learn methods for detecting and characterizing peptide nucleic acid hybrids using gel shift and fluorescence assays. Covers molecular mechanisms, biological ...
Peptide nucleic acid hybrid: Comprehensive Peptide Reference
Comprehensive reference for peptide nucleic acid hybrid, covering molecular structure, pharmacological properties, receptor interactions,
Peptide nucleic acid: Oligopeptide Research Reference
Comprehensive reference for peptide nucleic acid, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Ophthalmic Drug Development
Development of peptide therapeutics for eye diseases including formulation challenges. This peptide or oligopeptide is studied for its biological activity, s...
Peptide Ophthalmic Therapeutics
Therapeutic peptides for eye diseases including glaucoma, macular degeneration, and dry eye syndrome. This peptide or oligopeptide is studied for its biologi...
Peptide oxidation analysis: Comprehensive Peptide Reference
Comprehensive reference for peptide oxidation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Palmitoylation Sites: Comprehensive Peptide Refer...
Learn about S-palmitoylation in peptide membrane targeting and signal transduction. This modification affects peptide stability, receptor binding, and biolog...
Peptide palmitoylation: Oligopeptide Research Reference
Comprehensive reference for peptide palmitoylation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Patent Strategy: Oligopeptide Research Reference
Intellectual property strategy for peptide drugs including composition of matter and formulation patents. This peptide or oligopeptide is studied for its bio...
Peptide Patents: Oligopeptide Research Reference
Intellectual property protection for peptide drugs, formulations, synthesis methods, and therapeutic applications. Key patent categories: composition of matt...
Peptide Patents: Oligopeptide Research Reference
Intellectual property strategies and patent landscape for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, structur...
Peptide PEG conjugation: Oligopeptide Research Reference
Comprehensive reference for peptide peg conjugation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide PEGylation Strategies: Comprehensive Peptide Refe...
PEG conjugation strategies for extending peptide half-life in vivo. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Peptide Pharmacovigilance: Comprehensive Peptide Reference
Post-market safety monitoring and adverse event reporting for peptide therapeutics. This peptide or oligopeptide is studied for its biological activity, stru...
Peptide phosphorylation analysis
Comprehensive reference for peptide phosphorylation analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Phosphorylation Sites: Comprehensive Peptide Refe...
Guide to phosphorylation of serine, threonine, and tyrosine residues in peptide signaling. This modification affects peptide stability, receptor binding, and...
Peptide Precision Medicine: Comprehensive Peptide Reference
Tailoring peptide therapeutics to individual patient profiles and biomarkers. This peptide or oligopeptide is studied for its biological activity, structure-...
Peptide Prenylation Sites: Comprehensive Peptide Reference
Overview of farnesyl and geranylgeranyl modifications anchoring peptides to membranes. This modification affects peptide stability, receptor binding, and bio...
Peptide prenylation: Oligopeptide Research Reference
Comprehensive reference for peptide prenylation, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Quality Control: Oligopeptide Research Reference
Analytical methods and specifications for peptide quality control including identity, purity, potency, and stability testing.
Peptide quaternary structure: Comprehensive Peptide Refer...
Comprehensive reference for peptide quaternary structure, covering molecular structure, pharmacological properties, receptor interactions,
Peptide racemization analysis: Comprehensive Peptide Refe...
Comprehensive reference for peptide racemization analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide radioactive labeling: Comprehensive Peptide Refer...
Comprehensive reference for peptide radioactive labeling, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Radioligand Therapy: Comprehensive Peptide Reference
Targeted radionuclide therapy using radiolabeled peptides for peptide receptor radionuclide therapy in neuroendocrine tumors.
Peptide random coil: Oligopeptide Research Reference
Comprehensive reference for peptide random coil, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Rare Disease Therapeutics
Therapeutic peptides for rare diseases including enzyme replacement therapies and hormone replacement. This peptide or oligopeptide is studied for its biolog...
Peptide Regulatory Approval Pathways
Navigating the regulatory pathways for peptide drug approval in major markets. This peptide or oligopeptide is studied for its biological activity, structure...
Peptide Regulatory Landscape: Comprehensive Peptide Refer...
Global regulatory frameworks governing peptide drug approval and marketing. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Peptide Regulatory Requirements
Regulatory framework for peptide drug development including CMC requirements. This peptide or oligopeptide is studied for its biological activity, structure-...
Peptide Release Kinetics: Oligopeptide Research Reference
Mathematical modeling of peptide release from delivery systems. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
Peptide Renal Therapeutics: Comprehensive Peptide Reference
Therapeutic peptides for kidney diseases including erythropoiesis-stimulating agents and phosphate binders. This peptide or oligopeptide is studied for its b...
Peptide Research in Animal Models
Use of animal models for studying peptide pharmacology, toxicology, and efficacy in preclinical drug development. Covers molecular mechanisms, biological act...
Peptide Respiratory Therapeutics
Therapeutic peptides for respiratory conditions including asthma, COPD, and pulmonary infections. This peptide or oligopeptide is studied for its biological ...
Peptide Responsive Delivery: Comprehensive Peptide Reference
Stimuli-responsive delivery systems for on-demand peptide release. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Peptide Scaffold System 1: Comprehensive Peptide Reference
A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Peptide Scaffold System 2: Comprehensive Peptide Reference
A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Peptide Scaffold System 3: Comprehensive Peptide Reference
A peptide-scaffold-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Peptide scaffold: Oligopeptide Research Reference
Comprehensive reference for peptide scaffold, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Self-Assembly: Oligopeptide Research Reference
Peptide self-assembly into nanostructures for drug delivery applications. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Peptide Self-Healing Materials
Self-assembling peptide materials with intrinsic self-healing properties for biomedical and structural applications. Covers molecular mechanisms, biological ...
Peptide sequencing: Oligopeptide Research Reference
Comprehensive reference for peptide sequencing, covering molecular structure, pharmacological properties, receptor interactions,
Peptide sheet assembly: Oligopeptide Research Reference
Comprehensive reference for peptide sheet assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide shelf life: Oligopeptide Research Reference
Comprehensive reference for peptide shelf life, covering molecular structure, pharmacological properties, receptor interactions,
Peptide side-chain modification
Comprehensive reference for peptide side-chain modification, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Spray-Drying: Oligopeptide Research Reference
Spray-drying technology for producing peptide microparticles for inhalation. This peptide or oligopeptide is studied for its biological activity, structure-a...
Peptide Stability GI Tract: Comprehensive Peptide Reference
Strategies for protecting peptides from gastrointestinal enzymatic degradation. This peptide or oligopeptide is studied for its biological activity, structur...
Peptide Stability in Blood: Comprehensive Peptide Reference
A comprehensive review of factors affecting peptide stability in circulation, including protease degradation pathways, half-life determination methods, and f...
Peptide Stability in Formulation
Pharmaceutical strategies for enhancing peptide drug stability including lyophilization, surfactant selection, antioxidant incorporation, and pH optimization.
Peptide Stability in Freeze-Thaw Cycles
Freeze-thaw cycles induce peptide aggregation and denaturation requiring cryoprotectant optimization and formulation strategies to maintain structural integr...
Peptide stability: Oligopeptide Research Reference
Comprehensive reference for peptide stability, covering molecular structure, pharmacological properties, receptor interactions,
Peptide stapling: Oligopeptide Research Reference
Comprehensive reference for peptide stapling, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Startup Ecosystem: Comprehensive Peptide Reference
Overview of the peptide startup landscape including companies and technology platforms. This peptide or oligopeptide is studied for its biological activity, ...
Peptide SUMOylation Sites: Comprehensive Peptide Reference
Guide to SUMO modification of peptides in nuclear transport and transcriptional regulation. This modification affects peptide stability, receptor binding, an...
Peptide Supply Chain Management
Managing the complex supply chain for peptide raw materials and finished products. This peptide or oligopeptide is studied for its biological activity, struc...
Peptide Supply Chain Management
Management of peptide raw materials, intermediates, and finished products throughout the pharmaceutical supply chain. Covers molecular mechanisms, biological...
Peptide surface modification: Comprehensive Peptide Refer...
Comprehensive reference for peptide surface modification, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Sustainability in Manufacturing
Green chemistry and sustainable practices in peptide manufacturing. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Peptide Theranostics in Nuclear Medicine
Combination of diagnostic imaging and therapeutic radionuclides using same peptide targeting vector for theranostic applications.
Peptide Theranostics: Oligopeptide Research Reference
Combining diagnostic and therapeutic functions in single peptide-based agents. This peptide or oligopeptide is studied for its biological activity, structure...
Peptide Therapeutic therapeutic-1
Comprehensive reference for peptide therapeutic therapeutic-1, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-10
Comprehensive reference for peptide therapeutic therapeutic-10, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-11
Comprehensive reference for peptide therapeutic therapeutic-11, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-12
Comprehensive reference for peptide therapeutic therapeutic-12, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-13
Comprehensive reference for peptide therapeutic therapeutic-13, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-14
Comprehensive reference for peptide therapeutic therapeutic-14, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-15
Comprehensive reference for peptide therapeutic therapeutic-15, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-16
Comprehensive reference for peptide therapeutic therapeutic-16, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-17
Comprehensive reference for peptide therapeutic therapeutic-17, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-18
Comprehensive reference for peptide therapeutic therapeutic-18, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-19
Comprehensive reference for peptide therapeutic therapeutic-19, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-2
Comprehensive reference for peptide therapeutic therapeutic-2, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-20
Comprehensive reference for peptide therapeutic therapeutic-20, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-21
Comprehensive reference for peptide therapeutic therapeutic-21, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-22
Comprehensive reference for peptide therapeutic therapeutic-22, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-23
Comprehensive reference for peptide therapeutic therapeutic-23, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-24
Comprehensive reference for peptide therapeutic therapeutic-24, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-25
Comprehensive reference for peptide therapeutic therapeutic-25, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-26
Comprehensive reference for peptide therapeutic therapeutic-26, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-27
Comprehensive reference for peptide therapeutic therapeutic-27, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-28
Comprehensive reference for peptide therapeutic therapeutic-28, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-29
Comprehensive reference for peptide therapeutic therapeutic-29, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-3
Comprehensive reference for peptide therapeutic therapeutic-3, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-30
Comprehensive reference for peptide therapeutic therapeutic-30, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-31
Comprehensive reference for peptide therapeutic therapeutic-31, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-32
Comprehensive reference for peptide therapeutic therapeutic-32, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-33
Comprehensive reference for peptide therapeutic therapeutic-33, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-34
Comprehensive reference for peptide therapeutic therapeutic-34, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-35
Comprehensive reference for peptide therapeutic therapeutic-35, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-36
Comprehensive reference for peptide therapeutic therapeutic-36, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-37
Comprehensive reference for peptide therapeutic therapeutic-37, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-38
Comprehensive reference for peptide therapeutic therapeutic-38, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-39
Comprehensive reference for peptide therapeutic therapeutic-39, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-4
Comprehensive reference for peptide therapeutic therapeutic-4, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-40
Comprehensive reference for peptide therapeutic therapeutic-40, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-41
Comprehensive reference for peptide therapeutic therapeutic-41, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-42
Comprehensive reference for peptide therapeutic therapeutic-42, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-43
Comprehensive reference for peptide therapeutic therapeutic-43, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-44
Comprehensive reference for peptide therapeutic therapeutic-44, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-45
Comprehensive reference for peptide therapeutic therapeutic-45, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-46
Comprehensive reference for peptide therapeutic therapeutic-46, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-47
Comprehensive reference for peptide therapeutic therapeutic-47, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-48
Comprehensive reference for peptide therapeutic therapeutic-48, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-49
Comprehensive reference for peptide therapeutic therapeutic-49, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-5
Comprehensive reference for peptide therapeutic therapeutic-5, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-50
Comprehensive reference for peptide therapeutic therapeutic-50, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-6
Comprehensive reference for peptide therapeutic therapeutic-6, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-7
Comprehensive reference for peptide therapeutic therapeutic-7, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-8
Comprehensive reference for peptide therapeutic therapeutic-8, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutic therapeutic-9
Comprehensive reference for peptide therapeutic therapeutic-9, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Therapeutics Article ${i}
peptide therapeutics 201, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 202, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 203, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 204, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 205, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 206, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 207, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 208, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 209, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 210, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 211, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 212, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 213, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 214, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 215, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 216, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 217, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 218, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 219, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 220, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 221, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 222, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 223, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 227, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 226, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 225, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 224, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 229, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 228, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 230, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 232, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 231, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 233, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 235, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 234, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 237, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 236, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 238, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 239, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 240, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 241, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 242, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 243, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 244, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 245, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 247, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 246, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 248, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 249, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 250, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 251, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 252, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 253, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 254, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 255, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 256, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 257, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 258, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 259, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 260, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 261, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 262, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 263, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 265, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 264, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 267, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 266, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 268, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 269, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 270, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 271, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 272, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 273, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 275, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 277, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 276, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 274, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 278, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 279, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 280, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 281, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 282, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 283, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 284, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 285, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 287, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 286, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 289, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 288, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 290, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 291, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 292, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 293, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 294, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 295, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 296, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 297, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 298, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 299, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 300, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 301, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 302, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 303, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 305, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 304, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 306, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 307, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 308, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 309, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 310, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 311, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 312, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 313, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 314, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 315, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 316, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 317, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 318, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 319, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 320, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 321, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 322, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 323, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 324, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 325, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 326, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 327, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 328, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 329, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 330, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 331, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 332, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 333, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 334, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 335, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 337, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 336, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 338, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 339, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 340, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 341, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 342, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 343, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 344, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 346, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 347, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 345, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 348, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 349, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 350, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 352, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 351, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 353, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 354, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 355, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 357, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 356, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 358, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 359, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 360, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 361, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 362, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 363, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 365, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 364, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 366, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 367, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 368, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 369, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 370, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 372, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 371, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 373, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 374, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 375, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 376, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 377, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 378, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 379, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 380, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 382, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 381, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 383, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 384, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 385, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 387, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 386, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 388, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 389, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 390, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 392, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 391, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 393, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 394, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 395, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 396, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 397, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 398, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 399, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 400, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 401, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 402, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 403, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 404, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 405, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 407, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 406, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 408, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 409, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 410, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 411, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 412, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 413, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 414, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 415, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 416, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 417, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 418, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 419, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 421, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 420, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 422, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 423, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 424, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 426, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 425, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 427, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 428, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 429, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 431, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 432, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 430, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 433, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 434, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 436, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 435, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 437, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 438, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 439, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 440, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 441, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 442, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 443, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 444, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 445, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 446, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 447, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 448, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 449, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 451, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 450, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 452, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 453, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 454, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 455, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 457, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 456, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 458, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 459, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 460, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 461, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 462, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 463, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 464, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 465, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 466, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 467, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 468, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 469, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 470, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 471, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 473, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 472, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 475, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 476, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 474, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 477, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 478, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 479, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 480, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 481, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 482, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 483, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 484, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 485, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 486, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 487, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 488, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 489, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 490, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 491, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 492, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 493, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 495, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 494, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 496, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 497, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 498, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 499, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Therapeutics Article ${i}
peptide therapeutics 500, a bioactive peptide with documented roles in metabolic regulation, receptor pharmacology, and therapeutic development in modern pep...
Peptide Toxins as Research Tools
Conotoxins and spider venom peptides serve as highly specific ion channel probes and drug discovery leads for neuroscience research and therapeutic development.
Peptide tube assembly: Oligopeptide Research Reference
Comprehensive reference for peptide tube assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Tumor Targeting: Oligopeptide Research Reference
Peptide-based tumor targeting for drug delivery and imaging. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...
Peptide turn assembly: Oligopeptide Research Reference
Comprehensive reference for peptide turn assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide ubiquitination analysis
Comprehensive reference for peptide ubiquitination analysis, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Ubiquitination Sites: Comprehensive Peptide Refer...
Explore ubiquitin conjugation to lysine residues and its role in peptide degradation. This modification affects peptide stability, receptor binding, and biol...
Peptide Urological Therapeutics
Therapeutic peptides for urological conditions including overactive bladder and erectile dysfunction. This peptide or oligopeptide is studied for its biologi...
Peptide Vaccine Delivery: Oligopeptide Research Reference
Peptide-based vaccine delivery systems including adjuvant formulations. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peptide Vaccine Design: Oligopeptide Research Reference
Principles of peptide-based vaccine development including epitope prediction, adjuvant selection, and nanoparticle delivery strategies for enhanced immunogen...
Peptide Vaccine Immunotherapy: Comprehensive Peptide Refe...
Cancer peptide vaccines using tumor-associated antigen peptides to stimulate anti-tumor immune responses. This peptide or oligopeptide is studied for its bio...
Peptide Vaccines for Cancer: Comprehensive Peptide Reference
Tumor-associated antigens and neoantigen peptide vaccines combined with checkpoint inhibitors demonstrate promising immunogenicity and clinical responses acr...
Peptide Vaccines: Oligopeptide Research Reference
Learn about peptide-based vaccine design targeting B-cell and T-cell epitopes. This peptide or oligopeptide is studied for its biological activity, structure...
Peptide vesicle assembly: Oligopeptide Research Reference
Comprehensive reference for peptide vesicle assembly, covering molecular structure, pharmacological properties, receptor interactions,
Peptide Veterinary Therapeutics
Use of peptide therapeutics in veterinary medicine for companion animals, livestock, and aquaculture. This peptide or oligopeptide is studied for its biologi...
Peptide YY Hormone: Endogenous Peptide Hormone Reference
Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Peptide YY Peptide Hormone: Comprehensive Peptide Reference
Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Peptide YY Protein Hormone: Comprehensive Peptide Reference
Peptide YY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Peptide YY: Endogenous Peptide Hormone Reference
36-amino acid gut hormone released postprandially that suppresses appetite and slows gastric emptying through Y2 receptor signaling.
Peptide YY: Neuropeptide in Neuroscience Reference
GI-derived neuropeptide suppressing appetite and slowing gastric emptying. This neuropeptide is involved in neurological signaling and is studied for its rol...
Peptide α-Methylation: Oligopeptide Research Reference
Introduction of methyl group at α-carbon of amino acid residue. Increases metabolic stability, reduces proteolytic degradation, and can modify conformation. ...
Peptide-Aptamer Hybrids: Oligopeptide Research Reference
Chimeric molecules combining peptide and nucleic acid aptamer elements for enhanced target binding and cellular uptake. Covers molecular mechanisms, biologic...
Peptide-Based Biosensors: Oligopeptide Research Reference
A review of peptide-based biosensing platforms including aptamers, molecular imprinted polymers, and lateral flow assays for diagnostic applications.
Peptide-Based Contrast Agents: Comprehensive Peptide Refe...
Radiolabeled peptides and MRI contrast agents enable targeted tumor imaging through receptor-mediated accumulation, improving diagnostic sensitivity and trea...
Peptide-Based COVID Vaccines: Comprehensive Peptide Refer...
Comprehensive reference for Peptide-Based COVID Vaccines, a peptide compound with applications in research and therapeutics.
Peptide-Based Drug Design: Comprehensive Peptide Reference
Resource on computational approaches to peptide drug design. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...
Peptide-Based Hydrogels for Wound Healing
RADA16 self-assembling peptides form hydrogels with antimicrobial activity and hemostatic properties, accelerating tissue repair through biomimetic extracell...
Peptide-carbohydrate conjugate
Comprehensive reference for peptide-carbohydrate conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Peptide-DM1 Conjugates: Oligopeptide Research Reference
Peptide-DM1 Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Peptide-Docetaxel Conjugates: Comprehensive Peptide Refer...
Comprehensive reference for Peptide-Docetaxel Conjugates, a peptide compound with applications in research and therapeutics.
Peptide-Drug Conjugate Technology
Antibody-peptide conjugate and small molecule-peptide conjugate technologies for targeted drug delivery. This peptide or oligopeptide is studied for its biol...
Peptide-drug conjugate: Oligopeptide Research Reference
Comprehensive reference for peptide-drug conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Peptide-Enzyme: Oligopeptide Research Reference
DPP-4, ACE, Neprilysin, Insulin RTK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Peptide-Exosome Therapeutics: Comprehensive Peptide Refer...
Exosome-based delivery of therapeutic peptides using natural extracellular vesicles as biocompatible carriers. This peptide or oligopeptide is studied for it...
Peptide-Ligand: Oligopeptide Research Reference
Biotin-streptavidin, His-NiNTA, GST-GSH, FLAG, HA. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Peptide-lipid conjugate: Oligopeptide Research Reference
Comprehensive reference for peptide-lipid conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Peptide-Loaded Microspheres: Comprehensive Peptide Reference
Learn PLGA microsphere formulations for sustained-release injectable peptide depot delivery. This peptide or oligopeptide is studied for its biological activ...
Peptide-Loaded Nanoparticles: Comprehensive Peptide Refer...
An examination of nanoparticle-based delivery systems for therapeutic peptides, covering PLGA, liposomes, and chitosan carriers with sustained release and ta...
Peptide-MMAE Conjugates: Oligopeptide Research Reference
Peptide-MMAE Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Peptide-Modified Liposomes: Comprehensive Peptide Reference
Cell-penetrating peptides and RGD-targeted liposomes enhance drug delivery through receptor-mediated uptake and endosomal escape mechanisms for improved intr...
Peptide-Modified Surfaces: Comprehensive Peptide Reference
Biomaterial functionalization with adhesive peptides enhances cell adhesion and biocompatibility, enabling implant coatings that promote tissue integration a...
Peptide-oligonucleotide conjugate
Comprehensive reference for peptide-oligonucleotide conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Peptide-Peptide Interactions: Comprehensive Peptide Refer...
Molecular principles governing peptide association including coiled-coil assembly, leucine zipper formation, and amyloid fibril nucleation and propagation.
Peptide-Peptide: Oligopeptide Research Reference
Disulfide bonds, amyloid aggregation, collagen, fibrin. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Peptide-polymer conjugate: Comprehensive Peptide Reference
Comprehensive reference for peptide-polymer conjugate, covering molecular structure, pharmacological properties, receptor interactions,
Peptide-Protein Interaction Design
Computational and experimental approaches to designing peptide-protein interactions. This peptide or oligopeptide is studied for its biological activity, str...
Peptide-Protein Stapling: Oligopeptide Research Reference
Chemical stapling of peptides to proteins for enhanced stability, cell penetration, and target binding. This peptide or oligopeptide is studied for its biolo...
Peptide-Protein: Oligopeptide Research Reference
Ubiquitin-proteasome, MHC, TCR, BCR. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Peptide-Quantum Dot Conjugates
Bioconjugation of peptides to semiconductor quantum dots for bioimaging, sensing, and targeted delivery applications. Covers molecular mechanisms, biological...
Peptide-Receptor Internalization
Clathrin-mediated endocytosis and caveolae pathways govern peptide-receptor internalization and intracellular trafficking, determining signal termination and...
Peptide-Receptor: Oligopeptide Research Reference
GLP-1R, IR, OXTR, V1aR, V2R, GnRHR, SSTR2, CGRP-R, Y1R, OX1R. This peptide or oligopeptide is studied for its biological activity, structure-activity relatio...
Peptide-SN-38 Conjugates: Oligopeptide Research Reference
Comprehensive reference for Peptide-SN-38 Conjugates, a peptide compound with applications in research and therapeutics.
PeptideAtlas: Oligopeptide Research Reference
Database of peptide and protein mass spectrometry data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Peptidomimetic System 1: Oligopeptide Research Reference
A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Peptidomimetic System 2: Oligopeptide Research Reference
A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Peptidomimetic System 3: Oligopeptide Research Reference
A peptidomimetic-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Peptidomimetic: Oligopeptide Research Reference
Comprehensive reference for peptidomimetic, covering molecular structure, pharmacological properties, receptor interactions,
Peptidomimetics: Post-Translational Modification Reference
Overview of peptidomimetic compounds designed to overcome peptide drug limitations. This modification affects peptide stability, receptor binding, and biolog...
Permeation Enhancer Oral: Oligopeptide Research Reference
Chemical permeation enhancers increasing intestinal peptide absorption. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Peroxiredoxin 1: Oligopeptide Research Reference
peroxiredoxin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Persephin Hormone: Endogenous Peptide Hormone Reference
Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Persephin Peptide Hormone: Comprehensive Peptide Reference
Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Persephin Protein Hormone: Comprehensive Peptide Reference
Persephin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
Pexiganan: Antimicrobial Peptide Reference
Synthetic magainin analog antimicrobial peptide for diabetic foot ulcer infections with broad-spectrum activity. Covers molecular mechanisms, biological acti...
Pfam Resource: Oligopeptide Research Reference
The Pfam database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
PfSPZ: Oligopeptide Research Reference
PfSPZ, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PG-1 (Porcine): Oligopeptide Research Reference
PG-1 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PG-2 (Porcine): Oligopeptide Research Reference
PG-2 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PG-3 (Porcine): Oligopeptide Research Reference
PG-3 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PG-4 (Porcine): Oligopeptide Research Reference
PG-4 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PG-5 (Porcine): Oligopeptide Research Reference
PG-5 (Porcine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PGLa: Antimicrobial Peptide Reference
Amphibian antimicrobial peptide from Xenopus laevis that synergizes with magainin 2 for enhanced membrane disruption. Covers molecular mechanisms, biological...
PGLa: Antimicrobial Peptide Reference
Antimicrobial peptide from Xenopus skin with synergistic activity with magainin. This antimicrobial peptide demonstrates activity against pathogens and is st...
PH Cleavable Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using PH Cleavable. This analytical technique provides valuable insights into peptide structur...
Phallacidin: Oligopeptide Research Reference
Phallacidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phalloidin: Oligopeptide Research Reference
Phalloidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
pharmacodynamic-response Resource
The pharmacodynamic-response database or resource for peptide research, providing data on structure, function, and interactions.
pharmacokinetic-response Resource
The pharmacokinetic-response database or resource for peptide research, providing data on structure, function, and interactions.
Pharmacovigilance for Peptides
Learn pharmacovigilance practices for monitoring peptide drug safety including adverse event reporting and signal detection.
Phaseolin: Oligopeptide Research Reference
Phaseolin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phenylalanine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Phenylalanine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological...
Phenylalanine Modification: Comprehensive Peptide Reference
Post-translational modifications of Phenylalanine including phosphorylation, methylation, acetylation, and ubiquitination.
Phenylalanine Peptide: Oligopeptide Research Reference
Phenylalanine (F) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological ...
Phenylketonuria (PKU): Oligopeptide Research Reference
Phenylketonuria (PKU), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phenylketonuria: Oligopeptide Research Reference
PAH deficiency → elevated phenylalanine. Treatments: diet, pegvaliase, sapropterin. This peptide or oligopeptide is studied for its biological activity, stru...
Pheromone Biosynthesis Activating Neuropeptide (PBAN)
Comprehensive reference for Pheromone Biosynthesis Activating Neuropeptide (PBAN), a peptide compound with applications in research and therapeutics.
phi-psi-map Resource: Oligopeptide Research Reference
The phi-psi-map database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Philanthotoxin (Philanthus): Comprehensive Peptide Reference
Comprehensive reference for Philanthotoxin (Philanthus), a peptide compound with applications in research and therapeutics.
Philanthotoxin: Peptide Toxin in Pharmacology Reference
Philanthotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phoratoxin: Oligopeptide Research Reference
Phoratoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phosphatase Inhibitor PDC: Comprehensive Peptide Reference
A peptide-drug conjugate targeting Phosphatase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, st...
Phosphatase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Phosphatase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Phospho-tau 181 (p-tau181): Comprehensive Peptide Reference
Comprehensive reference for Phospho-tau 181 (p-tau181), a peptide compound with applications in research and therapeutics.
Phospho-tau 217 (p-tau217): Comprehensive Peptide Reference
Comprehensive reference for Phospho-tau 217 (p-tau217), a peptide compound with applications in research and therapeutics.
Phospho-tau 231 (p-tau231): Comprehensive Peptide Reference
Comprehensive reference for Phospho-tau 231 (p-tau231), a peptide compound with applications in research and therapeutics.
Phosphocarnosine: Oligopeptide Research Reference
phosphocarnosine is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Phosphodiester Bonds in Peptides
Learn about phosphodiester linkages in nucleopeptide conjugates and bioconjugation. This modification affects peptide stability, receptor binding, and biolog...
Phospholipase A2 (Api m 1): Comprehensive Peptide Reference
Comprehensive reference for Phospholipase A2 (Api m 1), a peptide compound with applications in research and therapeutics.
Phospholipase A2 (Bee): Peptide Toxin in Pharmacology Ref...
Phospholipase A2 (Bee), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phospholipase A2 SvPLA2: Peptide Toxin in Pharmacology Re...
phospholipase-A2-svPLA2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its p...
Phospholipase a2: Structure, Function, and Significance
Phospholipase A2 peptides from cobra venom hydrolyze membrane phospholipids, causing cell lysis and inflammation. Covers molecular mechanisms, biological act...
Phosphorodiamidate morpholino: Comprehensive Peptide Refe...
Comprehensive reference for phosphorodiamidate morpholino, covering molecular structure, pharmacological properties, receptor interactions,
Phosphorothioate RNA: Oligopeptide Research Reference
Comprehensive reference for phosphorothioate rna, covering molecular structure, pharmacological properties, receptor interactions,
Phosphorylation: Oligopeptide Research Reference
Addition of phosphate group to serine, threonine, or tyrosine. Key regulatory modification. This peptide or oligopeptide is studied for its biological activi...
Photo Cleavable Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Photo Cleavable. This analytical technique provides valuable insights into peptide struc...
Photochemical Synthesis: Analytical Technique in Peptide ...
A peptide synthesis method using Photochemical for producing peptides with specific properties. This analytical technique provides valuable insights into pep...
Photochemical Synthesis: Oligopeptide Research Reference
Using light to drive peptide bond formation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Phrixotoxin 1: Peptide Toxin in Pharmacology Reference
phrixotoxin-1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...
Phrixotoxin 2: Peptide Toxin in Pharmacology Reference
phrixotoxin-2 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...
PhTx3: Peptide Toxin in Pharmacology Reference
PhTx3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phyllocerulein: Antimicrobial Peptide Reference
Phyllocerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phyllokinin: Antimicrobial Peptide Reference
Phyllokinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Phylloseptin: Antimicrobial Peptide Reference
Tridecapeptide from Phyllomedusa frog skin with membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathogens and is studi...
Phytosulfokine: Oligopeptide Research Reference
Phytosulfokine, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
pI Resource: Oligopeptide Research Reference
The pI database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its bi...
PI3 Kinase Modulator: Oligopeptide Research Reference
PI3 kinase modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potentia...
PI3K Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PI3K Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
PI3K Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PI3K Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PI3K Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PI3K Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PI3K Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the PI3K signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Pigeon Crop Milk Peptides: Comprehensive Peptide Reference
Comprehensive reference for Pigeon Crop Milk Peptides, a peptide compound with applications in research and therapeutics.
Pigeon Pituitary Peptide Extract
Comprehensive reference for Pigeon Pituitary Peptide Extract, a peptide compound with applications in research and therapeutics.
PIK3CA Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PIK3CA Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structu...
Pine-nut Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pine-nut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
PIONEER 9 Trial: Oligopeptide Research Reference
Clinical trial evaluating iGlarLixi fixed-ratio glargine-lixisenatide versus glargine alone. This peptide or oligopeptide is studied for its biological activ...
Piscidin 1: Oligopeptide Research Reference
Piscidin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Piscidin 2: Oligopeptide Research Reference
Piscidin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Piscidin 3: Oligopeptide Research Reference
Piscidin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Piscidin 4: Oligopeptide Research Reference
Piscidin 4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Piscidin: Structure, Function, and Significance
Piscidins are antimicrobial peptides found in fish mast cells. They have broad-spectrum activity against bacteria, fungi, and parasites.
Pistachio Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pistachio with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
Pituitary Adenylate Cyclase-Activating Peptide
38-amino acid neuropeptide with neuroprotective, vasodilatory, and immunomodulatory effects through VPAC and PAC1 receptors.
Pituitary Extract Peptides (Pigeon)
Comprehensive reference for Pituitary Extract Peptides (Pigeon), a peptide compound with applications in research and therapeutics.
PKA Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKA Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKA Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKA Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKA Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the PKA signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
pKa Resource: Oligopeptide Research Reference
The pKa database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
PKC activation via phorbol ester mimicry
Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
PKC Modulator: Oligopeptide Research Reference
PKC modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
PKC Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKC Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKC Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKC Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
PKC Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the PKC signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Planaria Peptides: Oligopeptide Research Reference
Planaria Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Plant Bioactive Peptides: Oligopeptide Research Reference
Plant Bioactive Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Plant Cyclic Peptides: Oligopeptide Research Reference
Plant Cyclic Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologi...
Plant Defense Peptides: Oligopeptide Research Reference
Plant Defense Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Plant Signaling Peptides: Oligopeptide Research Reference
Plant Signaling Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biol...
Plant Storage Peptides: Oligopeptide Research Reference
Plant Storage Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biolog...
Plant Toxic Peptides: Oligopeptide Research Reference
Plant Toxic Peptides is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Plant: Peptide Toxin in Pharmacology Reference
~0.003 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resea...
Plantaricin: Antimicrobial Peptide Reference
plantaricin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Plasma Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Plasma for producing peptides with specific properties. This analytical technique provides valuable insights into peptide st...
Plasmin Inhibitor: Enzyme in Peptide Biology Reference
plasmin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate speci...
Plasmodium falciparum: Oligopeptide Research Reference
Binds erythrocyte membrane, remodels host cell. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Platelet Derived Growth Factor AA-1-106
Comprehensive reference for platelet derived growth factor AA-1-106, covering molecular structure, pharmacological properties, receptor interactions,
Platelet Derived Growth Factor AB
Comprehensive reference for platelet derived growth factor AB, covering molecular structure, pharmacological properties, receptor interactions,
Platelet Derived Growth Factor BB-1-109
Comprehensive reference for platelet derived growth factor BB-1-109, covering molecular structure, pharmacological properties, receptor interactions,
Platelet Derived Growth Factor fragment-1-30
Comprehensive reference for platelet derived growth factor fragment-1-30, covering molecular structure, pharmacological properties, receptor interactions,
Platelet Derived Growth Factor fragment-40-70
Comprehensive reference for platelet derived growth factor fragment-40-70, covering molecular structure, pharmacological properties, receptor interactions,
Platelet Derived Growth Factor fragment-70-109
Comprehensive reference for platelet derived growth factor fragment-70-109, covering molecular structure, pharmacological properties, receptor interactions,
Plazomicin: Oligopeptide Research Reference
Plazomicin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Plecanatide - CIC (NCT01996240)
Trial of plecanatide for chronic idiopathic constipation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationshi...
Plecanatide - First-in-Human (NCT01588543)
First-in-human trial of plecanatide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Plecanatide: Oligopeptide Research Reference
Plecanatide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pleurocidin: Oligopeptide Research Reference
Pleurocidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PLGA Microsphere System 1: Comprehensive Peptide Reference
A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
PLGA Microsphere System 2: Comprehensive Peptide Reference
A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
PLGA Microsphere System 3: Comprehensive Peptide Reference
A PLGA-microsphere-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
PLGA microsphere: Oligopeptide Research Reference
Comprehensive reference for plga microsphere, covering molecular structure, pharmacological properties, receptor interactions,
PLGA Nanoparticles Peptide: Comprehensive Peptide Reference
Poly(lactide-co-glycolide) nanoparticles for sustained peptide drug release. This peptide or oligopeptide is studied for its biological activity, structure-a...
Plicamycin (Mithramycin): Oligopeptide Research Reference
Aureolic acid antibiotic from Streptomyces inhibiting RNA synthesis, used for testicular cancer and hypercalcemia. Covers molecular mechanisms, biological ac...
Plitidepsin T-Cell Lymphoma Agent
Depsipeptide from marine tunicate Aplidium albicans for relapsed/refractory T-cell lymphoma through translation inhibition.
Plitidepsin: Oligopeptide Research Reference
Marine-derived depsipeptide that inhibits eEF1A, used for multiple myeloma with antiviral activity against SARS-CoV-2. Covers molecular mechanisms, biologica...
PMAP 23: Antimicrobial Peptide Reference
PMAP-23 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...
PMAP 36: Antimicrobial Peptide Reference
PMAP-36 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...
PMAP 37: Antimicrobial Peptide Reference
PMAP-37 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...
PMDA Peptide Drug Approval: Comprehensive Peptide Reference
Navigate the Japanese Pharmaceuticals and Medical Devices Agency pathway for peptide drug registration. This peptide or oligopeptide is studied for its biolo...
PNA System 1: Oligopeptide Research Reference
A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
PNA System 2: Oligopeptide Research Reference
A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
PNA System 3: Oligopeptide Research Reference
A PNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologica...
Pneumocandin B0: Oligopeptide Research Reference
Pneumocandin B0, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pneumonia Peptides: Oligopeptide Research Reference
Peptides associated with Pneumonia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...
Pneumonia: Oligopeptide Research Reference
Lung infection. Treatments: antibiotics based on pathogen. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
PnTx2 6: Peptide Toxin in Pharmacology Reference
pnTx2-6 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pha...
Point-of-Care Testing: Oligopeptide Research Reference
Peptide-based point-of-care diagnostic tests. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
POL7080: Oligopeptide Research Reference
POL7080, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
polarizability Resource: Oligopeptide Research Reference
The polarizability database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Polatuzumab Vedotin: Oligopeptide Research Reference
Anti-CD79b antibody-drug conjugate with MMAE payload for relapsed or refractory diffuse large B-cell lymphoma. This peptide or oligopeptide is studied for it...
Pollinex Quattro: Oligopeptide Research Reference
Pollinex Quattro, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Poly-Arg Peptides: Oligopeptide Research Reference
Poly-Arg Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Polybia-MP1 (Polybia): Oligopeptide Research Reference
Polybia-MP1 (Polybia), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Polymer Conjugate System 1: Comprehensive Peptide Reference
A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...
Polymer Conjugate System 2: Comprehensive Peptide Reference
A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...
Polymer Conjugate System 3: Comprehensive Peptide Reference
A polymer-conjugate-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key cha...
Polymer Conjugation Synthesis: Comprehensive Peptide Refe...
A peptide synthesis method using Polymer Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...
Polymer-Peptide Conjugates: Comprehensive Peptide Reference
Learn PEGylation and polymer conjugation strategies for extending peptide half-life and reducing immunogenicity. Covers molecular mechanisms, biological acti...
Polymerase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Polymerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...
Polymyxin B: Oligopeptide Research Reference
Cyclic lipopeptide antibiotic binding lipopolysaccharide for multidrug-resistant gram-negative infections. This peptide or oligopeptide is studied for its bi...
Polymyxin B1: Oligopeptide Research Reference
Polymyxin B1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Polymyxin B2: Antimicrobial Peptide Reference
polymyxin-B2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Polymyxin E: Antimicrobial Peptide Reference
polymyxin-E is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Polymyxin E1: Antimicrobial Peptide Reference
polymyxin-E1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Polymyxin E2: Antimicrobial Peptide Reference
polymyxin-E2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Polymyxin M: Antimicrobial Peptide Reference
polymyxin-M is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Polymyxins: Oligopeptide Research Reference
Antimicrobial (Gram-negative). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
Polyphemusin: Antimicrobial Peptide Reference
AMP from horseshoe crab with anti-HIV activity through CXCR4 blockade. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...
Pomegranate Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pomegranate with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-a...
Pompe Disease: Oligopeptide Research Reference
Acid α-glucosidase deficiency → glycogen accumulation. Treatments: alglucosidase alfa, avalglucosidase alfa. This peptide or oligopeptide is studied for its ...
Ponericin (Pachycondyla): Oligopeptide Research Reference
Comprehensive reference for Ponericin (Pachycondyla), a peptide compound with applications in research and therapeutics.
Porcine Antimicrobial: Oligopeptide Research Reference
Porcine Antimicrobial is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologi...
Porcine Cathelicidin PMAP-36: Comprehensive Peptide Refer...
Cathelicidin from porcine neutrophils with potent gram-negative bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and...
Porcine Defensin PR-39: Antimicrobial Peptide Reference
Proline-arginine-rich antibiotic from porcine neutrophils inhibiting protein synthesis. This antimicrobial peptide demonstrates activity against pathogens an...
Positional Encoding for Peptides
A computational method for studying peptides using Positional Encoding. This analytical technique provides valuable insights into peptide structure, purity, ...
Post-Market Surveillance for Peptides
Explore post-marketing surveillance obligations for peptide drugs including safety monitoring and risk management plans.
Potato Peptide: Oligopeptide Research Reference
A bioactive peptide derived from potato with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Potato Spudin: Oligopeptide Research Reference
potato spudin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Potency Testing (Bioassay): Comprehensive Peptide Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Potency Testing: Oligopeptide Research Reference
Potency Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PP Hormone: Endogenous Peptide Hormone Reference
PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
PP inhibition with homoarginine variant
Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
PP Peptide Hormone: Endogenous Peptide Hormone Reference
PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
PP Protein Hormone: Endogenous Peptide Hormone Reference
PP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signifi...
PP-001: Oligopeptide Research Reference
ADDMADMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
PP-003: Oligopeptide Research Reference
ADDMADMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
PP-005: Oligopeptide Research Reference
MDMSTLADDLAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
PP-007: Oligopeptide Research Reference
N-hydroxyguanidine organophosphate. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
PP-009: Oligopeptide Research Reference
KNYLSLPTQSN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical ...
PP-011: Oligopeptide Research Reference
NNLNKLKESLHYF. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
PP-013: Oligopeptide Research Reference
YKKLNELQNYLEKH. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
PP-015: Oligopeptide Research Reference
KNGNKNKNKNKGQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
PP-017: Oligopeptide Research Reference
YNKLKHESSYTGY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
PP-019: Oligopeptide Research Reference
GGPLGPGGPLGPG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
PP-021: Oligopeptide Research Reference
QNCLNGSYCPGQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
PP-023: Oligopeptide Research Reference
KFLGKLAGKLAG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
PP-025: Oligopeptide Research Reference
DSGYDGSGYD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical r...
PP-027: Oligopeptide Research Reference
NDFVNLKNKLIEN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
PP-029: Oligopeptide Research Reference
KNGLNGLNNLNN. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
PP-031: Oligopeptide Research Reference
Zwitterionic guanidinium compound. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
PP-033: Oligopeptide Research Reference
Ladder-frame polyether peptide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
PP-035: Oligopeptide Research Reference
Large ladder polyether. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
PP1/PP2A inhibition via Adda moiety binding
Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
PPV Resource: Oligopeptide Research Reference
The PPV database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its b...
PR-39: Antimicrobial Peptide Reference
Porcine proline-rich antimicrobial peptide that inhibits bacterial protein synthesis and promotes wound healing through non-lytic mechanisms.
PR-39: Oligopeptide Research Reference
PR-39, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Pramlintide: Oligopeptide Research Reference
pramlintide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Pramlintide: Oligopeptide Research Reference
Synthetic amylin analog that slows gastric emptying and suppresses glucagon for improved glycemic control in diabetes. Covers molecular mechanisms, biologica...
Pramlintide: Oligopeptide Research Reference
Pramlintide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Precipitation Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Precipitation. This analytical technique provides valuable insights into peptide structu...
Precipitation: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
precision Resource: Oligopeptide Research Reference
The precision database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Pregnancy: Oligopeptide Research Reference
Safety considerations for peptide drugs during pregnancy and lactation. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Premixed Insulin 50/50: Peptide Family Reference
Equal-ratio premixed insulin containing 50% intermediate-acting protamine lispro and 50% rapid-acting insulin lispro. Covers molecular mechanisms, biological...
Premixed Insulin 70/30: Oligopeptide Research Reference
Fixed combination of 70% NPH intermediate-acting and 30% regular insulin for twice-daily basal-bolus coverage. This peptide or oligopeptide is studied for it...
Premixed Insulin 75/25: Peptide Family Reference
Fixed-ratio premixed insulin containing 75% intermediate-acting protamine lispro and 25% rapid-acting insulin lispro. Covers molecular mechanisms, biological...
Preparative Chromatography: Comprehensive Peptide Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
prevalence Resource: Oligopeptide Research Reference
The prevalence database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ac...
PRIDE: Oligopeptide Research Reference
Proteomics Identifications Database for mass spectrometry data. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
primary-endpoint Resource: Comprehensive Peptide Reference
The primary-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
Principal Component for Peptides
A computational method for studying peptides using Principal Component. This analytical technique provides valuable insights into peptide structure, purity, ...
Prion Diseases: Oligopeptide Research Reference
Transmissible spongiform encephalopathies caused by PrPSc. This peptide or oligopeptide is studied for its biological activity, structure-activity relationsh...
Prion Protein (PrP): Oligopeptide Research Reference
Prion Protein (PrP), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Prion Protein (PrPSc): Oligopeptide Research Reference
Misfolded prion protein. Transmissible spongiform encephalopathies. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Prion protein folding: Oligopeptide Research Reference
Comprehensive reference for prion protein folding, covering molecular structure, pharmacological properties, receptor interactions,
Prion Protein Misfolding (Conformational Change)
Comprehensive reference for Prion Protein Misfolding (Conformational Change), a peptide compound with applications in research and therapeutics.
Procalcitonin (PCT): Oligopeptide Research Reference
Procalcitonin (PCT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Processed through secretory pathway by Kex2p and Ste13p
Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Progesterone Hormone: Endogenous Peptide Hormone Reference
Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Progesterone Peptide Hormone: Comprehensive Peptide Refer...
Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Progesterone Protein Hormone: Comprehensive Peptide Refer...
Progesterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
progression-free-survival Resource
The progression-free-survival database or resource for peptide research, providing data on structure, function, and interactions.
progressive-disease Resource: Comprehensive Peptide Refer...
The progressive-disease database or resource for peptide research, providing data on structure, function, and interactions.
Proinsulin: Oligopeptide Research Reference
Single-chain precursor of insulin containing A chain, B chain, and connecting C-peptide, cleaved to release mature insulin.
Prolactin Family Peptides: Comprehensive Peptide Reference
Learn about prolactin family peptides and their roles in lactation, reproduction, and immune modulation. This peptide or oligopeptide is studied for its biol...
Prolactin-Releasing Peptide: Comprehensive Peptide Reference
Hypothalamic peptide stimulating prolactin release from anterior pituitary. This neuropeptide is involved in neurological signaling and is studied for its ro...
Prolactin-Releasing Peptide: Comprehensive Peptide Reference
Prolactin-releasing peptide is a hypothalamic neuropeptide that stimulates prolactin secretion through GPR10 receptor activation in the anterior pituitary.
Proline Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Proline including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activ...
Proline Modification: Post-Translational Modification Ref...
Post-translational modifications of Proline including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological ...
Proline Peptide: Oligopeptide Research Reference
Proline (P) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for it...
Prolyl hydroxyproline: Structure, Function, and Significance
Prolyl-hydroxyproline (Pro-Hyp) is a bioactive dipeptide from collagen digestion that stimulates fibroblast proliferation and hyaluronic acid synthesis.
Prophenin: Oligopeptide Research Reference
Prophenin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PROSITE Resource: Oligopeptide Research Reference
The PROSITE database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...
Prostate Cancer Peptides: Oligopeptide Research Reference
Peptides associated with Prostate Cancer including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its b...
Prostate Cancer: Oligopeptide Research Reference
Malignant transformation of prostate epithelial cells. Most common cancer in men. Androgen-dependent in most cases. PSA screening: controversial (overdiagnos...
PROTAC degradation: Oligopeptide Research Reference
Comprehensive reference for protac degradation, covering molecular structure, pharmacological properties, receptor interactions,
PROTAC System 1: Oligopeptide Research Reference
A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
PROTAC System 2: Oligopeptide Research Reference
A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
PROTAC System 3: Oligopeptide Research Reference
A PROTAC-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in ...
Protease Inhibitor Delivery: Comprehensive Peptide Reference
Co-administered protease inhibitors protecting peptides from GI enzymatic degradation. This peptide or oligopeptide is studied for its biological activity, s...
Protease Inhibitor Interactions
Drug interactions between protease inhibitor peptides and other medications. This peptide or oligopeptide is studied for its biological activity, structure-a...
Protease Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Protease Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...
Protease PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Protease for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Proteasome Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Proteasome Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, str...
Proteasome PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Proteasome for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...
Protectin D1: Oligopeptide Research Reference
protectin D1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Protegrin 1: Antimicrobial Peptide Reference
Porcine antimicrobial peptide with beta-hairpin structure that rapidly kills multidrug-resistant bacteria through membrane disruption.
Protegrin 1: Oligopeptide Research Reference
Protegrin 1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Protegrin 2: Oligopeptide Research Reference
Protegrin 2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Protegrin 3: Oligopeptide Research Reference
Protegrin 3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Protein A Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using Protein A. This analytical technique provides valuable insights into peptide structure, ...
Protein Conjugation Synthesis: Comprehensive Peptide Refe...
A peptide synthesis method using Protein Conjugation for producing peptides with specific properties. This peptide or oligopeptide is studied for its biologi...
Protein G Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using Protein G. This analytical technique provides valuable insights into peptide structure, ...
Protein L Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using Protein L. This analytical technique provides valuable insights into peptide structure, ...
Protein phosphatase inhibition
Algae peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
Protein Purification / Biochemistry
Protein Purification / Biochemistry is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Protein Science: Oligopeptide Research Reference
Journal dedicated to protein structure, function, and engineering. This peptide or oligopeptide is studied for its biological activity, structure-activity re...
Protein Society: Oligopeptide Research Reference
Professional society for protein science research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
ProteinMPNN for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using ProteinMPNN. This analytical technique provides valuable insights into peptide structure, purity, and char...
Prothoracicotropic Hormone (PTTH)
Comprehensive reference for Prothoracicotropic Hormone (PTTH), a peptide compound with applications in research and therapeutics.
proton-affinity Resource: Oligopeptide Research Reference
The proton-affinity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...
ProTx-II: Peptide Toxin in Pharmacology Reference
ProTx-II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PS3: Oligopeptide Research Reference
Automated peptide synthesizer for SPPS with multiple reaction vessel capability. This peptide or oligopeptide is studied for its biological activity, structu...
PSA: Oligopeptide Research Reference
240-aa kallikrein-related peptidase (hK3) secreted by prostate epithelial cells. Cleaves semenogelin. Normal: <4 ng/mL (age-adjusted). Elevated in prostate c...
Psalmotoxin 1: Peptide Toxin in Pharmacology Reference
Psalmotoxin-1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for i...
Psi-Conotoxin TxVII: Peptide Toxin in Pharmacology Reference
Calcium channel modulator from Conus textile with unique disulfide connectivity. This peptide toxin is derived from venom and studied for its pharmacological...
PSK: Oligopeptide Research Reference
PSK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Psoriasis Peptides: Oligopeptide Research Reference
Peptides associated with Psoriasis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologi...
PTEN Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting PTEN Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
PTH (Parathyroid Hormone): Comprehensive Peptide Reference
Comprehensive reference for PTH (Parathyroid Hormone), a peptide compound with applications in research and therapeutics.
PTH 1-34: Peptide Fragment Reference
Comprehensive reference for PTH 1-34 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-38: Peptide Fragment Reference
Comprehensive reference for PTH 1-38 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-41: Peptide Fragment Reference
Comprehensive reference for PTH 1-41 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-44: Peptide Fragment Reference
Comprehensive reference for PTH 1-44 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-47: Peptide Fragment Reference
Comprehensive reference for PTH 1-47 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-50: Peptide Fragment Reference
Comprehensive reference for PTH 1-50 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-53: Peptide Fragment Reference
Comprehensive reference for PTH 1-53 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-56: Peptide Fragment Reference
Comprehensive reference for PTH 1-56 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-59: Peptide Fragment Reference
Comprehensive reference for PTH 1-59 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-62: Peptide Fragment Reference
Comprehensive reference for PTH 1-62 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-65: Peptide Fragment Reference
Comprehensive reference for PTH 1-65 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-68: Peptide Fragment Reference
Comprehensive reference for PTH 1-68 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-71: Peptide Fragment Reference
Comprehensive reference for PTH 1-71 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-74: Peptide Fragment Reference
Comprehensive reference for PTH 1-74 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-77: Peptide Fragment Reference
Comprehensive reference for PTH 1-77 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-80: Peptide Fragment Reference
Comprehensive reference for PTH 1-80 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-83: Peptide Fragment Reference
Comprehensive reference for PTH 1-83 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 1-84 Hypoparathyroidism: Comprehensive Peptide Reference
Full-length parathyroid hormone for hypoparathyroidism replacement providing calcium homeostasis. This peptide or oligopeptide is studied for its biological ...
PTH 1-84: Peptide Fragment Reference
Comprehensive reference for PTH 1-84 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 14-34: Peptide Fragment Reference
Comprehensive reference for PTH 14-34 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 3-34: Peptide Fragment Reference
Comprehensive reference for PTH 3-34 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH 7-34: Peptide Fragment Reference
Comprehensive reference for PTH 7-34 variant, covering molecular structure, pharmacological properties, receptor interactions,
PTH Hormone: Endogenous Peptide Hormone Reference
PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
PTH Peptide Hormone: Endogenous Peptide Hormone Reference
PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
PTH Protein Hormone: Endogenous Peptide Hormone Reference
PTH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
PubChem: Oligopeptide Research Reference
Chemical compound database with structures, properties, and bioactivity. This peptide or oligopeptide is studied for its biological activity, structure-activ...
PubMedBERT for Peptides: Analytical Technique in Peptide ...
A computational method for studying peptides using PubMedBERT. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Pufferfish: Peptide Toxin in Pharmacology Reference
0.008 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...
Pulchrinin: Peptide Toxin in Pharmacology Reference
pulchrinin is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for its p...
Pulmonary delivery: Oligopeptide Research Reference
Comprehensive reference for pulmonary delivery, covering molecular structure, pharmacological properties, receptor interactions,
Pulmonary Embolism: Oligopeptide Research Reference
Blood clot in pulmonary arteries. Usually from DVT. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
Pulmonary Fibrosis Peptides: Comprehensive Peptide Reference
Peptides associated with Pulmonary Fibrosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for it...
Pulmonary Peptide Delivery: Comprehensive Peptide Reference
Inhaled peptide formulations for lung delivery targeting respiratory or systemic effects. This peptide or oligopeptide is studied for its biological activity...
Pulmonary System 1: Oligopeptide Research Reference
A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Pulmonary System 2: Oligopeptide Research Reference
A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Pulmonary System 3: Oligopeptide Research Reference
A pulmonary-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Pumpkin Peptide: Oligopeptide Research Reference
A bioactive peptide derived from pumpkin with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
PUR-011: Oligopeptide Research Reference
High resolution, polishing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
PUR-012: Oligopeptide Research Reference
Charge-based, scalable. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
PUR-013: Oligopeptide Research Reference
Aggregate removal, desalting. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
PUR-014: Oligopeptide Research Reference
Highly selective, one-step. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
PUR-015: Oligopeptide Research Reference
Scalable, buffer exchange. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
PUR-016: Oligopeptide Research Reference
Solid form, high purity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
PUR-017: Oligopeptide Research Reference
Cost-effective, capture. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
PUR-018: Oligopeptide Research Reference
Hydrophobic impurity removal. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
PUR-019: Oligopeptide Research Reference
Industrial scale. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
PUR-020: Oligopeptide Research Reference
High resolution analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
Purification (10 processes): Comprehensive Peptide Reference
Comprehensive reference for Purification (10 processes), a peptide compound with applications in research and therapeutics.
Purity Testing (HPLC Analysis)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Purity Testing: Oligopeptide Research Reference
Purity Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PyMOL: Oligopeptide Research Reference
Molecular visualization system for 3D structures. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
PYY (3-36): Neuropeptide in Neuroscience Reference
PYY (3-36), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PYY → DPP-4 (Substrate): Oligopeptide Research Reference
PYY → DPP-4 (Substrate), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
PYY Hormone: Endogenous Peptide Hormone Reference
PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
PYY Peptide Hormone: Endogenous Peptide Hormone Reference
PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
PYY Protein Hormone: Endogenous Peptide Hormone Reference
PYY, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
QC-031: Oligopeptide Research Reference
Purity %. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical res...
QC-032: Oligopeptide Research Reference
Molecular weight, sequence. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications...
QC-033: Oligopeptide Research Reference
Biological activity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
QC-034: Oligopeptide Research Reference
Shelf life. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical r...
QC-035: Oligopeptide Research Reference
Microbial limits. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
QSAR for Peptides: Analytical Technique in Peptide Research
Discover quantitative structure-activity relationship modeling for predicting peptide biological activity from structure.
QSAR: Oligopeptide Research Reference
Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...
quadrupole-moment Resource: Comprehensive Peptide Reference
The quadrupole-moment database or resource for peptide research, providing data on structure, function, and interactions.
Quality by Design: Oligopeptide Research Reference
Quality by Design approach to peptide drug development. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Quality Control (5 processes): Comprehensive Peptide Refe...
Comprehensive reference for Quality Control (5 processes), a peptide compound with applications in research and therapeutics.
Quality Specifications: Oligopeptide Research Reference
Quality Specifications, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
quality-of-life Resource: Oligopeptide Research Reference
The quality-of-life database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologic...
Quantum Dot Labeling Synthesis
A peptide synthesis method using Quantum Dot Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Quantum Mechanics for Peptides
A computational method for studying peptides using Quantum Mechanics. This analytical technique provides valuable insights into peptide structure, purity, an...
Quasi Harmonic for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Quasi Harmonic. This analytical technique provides valuable insights into peptide structure, purity, and c...
Quaternary Interface 1: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 10: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 11: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 12: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 13: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 14: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 15: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 16: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 17: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 18: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 19: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 2: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 20: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 21: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 22: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 23: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 24: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 25: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 26: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 27: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 28: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 29: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 3: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 30: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 31: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 32: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 33: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 34: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 35: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 36: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 37: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 38: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 39: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 4: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 40: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 41: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 42: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 43: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 44: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 45: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 46: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 47: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 48: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 49: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 5: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 50: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 6: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 7: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 8: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quaternary Interface 9: Oligopeptide Research Reference
A peptide interface region involved in subunit-subunit interactions in protein complexes. This peptide or oligopeptide is studied for its biological activity...
Quercetin Peptide: Oligopeptide Research Reference
quercetin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Quinoa Peptide: Oligopeptide Research Reference
A bioactive peptide derived from quinoa with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
R21/Matrix-M: Oligopeptide Research Reference
R21/Matrix-M, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
R8 (Octa-Arginine): Oligopeptide Research Reference
R8 (Octa-Arginine), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Rabbit Cathelicidin CAP-18: Comprehensive Peptide Reference
Cathelicidin from rabbit neutrophils generating LL-37-equivalent active fragment. This antimicrobial peptide demonstrates activity against pathogens and is s...
Rabbit Defensin NP-1: Antimicrobial Peptide Reference
Neutrophil defensin from rabbit with broad-spectrum bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is studied ...
Rabies G Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Rabies G for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Rabies Peptides: Oligopeptide Research Reference
Peptides associated with Rabies including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Radioactive Labeling Synthesis
A peptide synthesis method using Radioactive Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Radiolabeled / Diagnostic: Comprehensive Peptide Reference
Radiolabeled / Diagnostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...
Radiolabeled / Theranostic: Comprehensive Peptide Reference
Radiolabeled / Theranostic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...
RAF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting RAF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
RAF Inhibitor: Oligopeptide Research Reference
RAF inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
RALF: Oligopeptide Research Reference
RALF, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ramachandran Resource: Oligopeptide Research Reference
The ramachandran database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological ...
Raman Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using Raman. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Raman Spectroscopy for Peptides
Explore Raman spectroscopy for label-free peptide structural characterization and conformational analysis. This peptide or oligopeptide is studied for its bi...
Ramipril: Oligopeptide Research Reference
Ramipril, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ranacyclin: Antimicrobial Peptide Reference
Cyclic AMP from Rana species with disulfide-stabilized structure. This antimicrobial peptide demonstrates activity against pathogens and is studied for its m...
Ranatensin: Antimicrobial Peptide Reference
Ranatensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ranatuerin 2CSa: Antimicrobial Peptide Reference
ranatuerin-2CSa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its b...
Ranatuerin 2CSb: Antimicrobial Peptide Reference
ranatuerin-2CSb is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its b...
Ranatuerin-2: Antimicrobial Peptide Reference
Ranatuerin-2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ranatuerin: Structure, Function, and Significance
Ranatuerins are antimicrobial peptides from frog skin with unique structural features that enhance membrane selectivity.
Random Coil System 1: Oligopeptide Research Reference
A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Random Coil System 2: Oligopeptide Research Reference
A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Random Coil System 3: Oligopeptide Research Reference
A random-coil-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Rare Disease / Enzyme Replacement Therapy
Rare Disease / Enzyme Replacement Therapy is a bioactive compound with applications in peptide research and therapeutics.
Rare Diseases and Peptides: Comprehensive Peptide Reference
Explore orphan peptide drugs for rare diseases including enzyme replacement therapies and receptor-targeting peptides. Covers molecular mechanisms, biologica...
Rare Diseases: Oligopeptide Research Reference
Peptide therapeutics for rare diseases. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
RAS Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting RAS Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
RAS Inhibitor: Oligopeptide Research Reference
RAS inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Ras-Raf-MEK-ERK Pathway Peptide 1
A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Ras-Raf-MEK-ERK Pathway Peptide 2
A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Ras-Raf-MEK-ERK Pathway Peptide 3
A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Ras-Raf-MEK-ERK Pathway Peptide 4
A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Ras-Raf-MEK-ERK Pathway Peptide 5
A peptide involved in the Ras-Raf-MEK-ERK signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Raspberry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from raspberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
RB1 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting RB1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Real-time quaking-induced conversion
Prion disease. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
Real-World Evidence: Oligopeptide Research Reference
Real-World Evidence, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Rebaudioside A: Oligopeptide Research Reference
rebaudioside A in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appl...
recall Resource: Oligopeptide Research Reference
The recall database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for it...
Recently Expired Patents: Oligopeptide Research Reference
Comprehensive reference for Recently Expired Patents, a peptide compound with applications in research and therapeutics.
Receptor binding on cell wall glucan
Yeast killer toxins. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
Receptor tyrosine kinase: Oligopeptide Research Reference
Comprehensive reference for receptor tyrosine kinase, covering molecular structure, pharmacological properties, receptor interactions,
Recombinant Actin: Oligopeptide Research Reference
recombinant actin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Recombinant Collagen I: Oligopeptide Research Reference
recombinant collagen I in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Recombinant Collagen III: Oligopeptide Research Reference
recombinant collagen III in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
Recombinant DNA technology, E. coli expression systems
Recombinant DNA technology, E. coli expression systems is a bioactive compound with applications in peptide research and therapeutics.
Recombinant Elastin: Oligopeptide Research Reference
recombinant elastin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Recombinant Expression: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Recombinant GFAP: Oligopeptide Research Reference
recombinant GFAP in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Recombinant Keratin: Oligopeptide Research Reference
recombinant keratin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Recombinant Lamin: Oligopeptide Research Reference
recombinant lamin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential a...
Recombinant Nestin: Oligopeptide Research Reference
recombinant nestin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Recombinant Resilin: Oligopeptide Research Reference
recombinant resilin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Recombinant Silk Fibroin: Oligopeptide Research Reference
recombinant silk fibroin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
Recombinant Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using Recombinant for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
Recombinant Tubulin: Oligopeptide Research Reference
recombinant tubulin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
recommended-phase2-dose Resource
The recommended-phase2-dose database or resource for peptide research, providing data on structure, function, and interactions.
Rectal Peptide Delivery: Oligopeptide Research Reference
Rectal delivery systems for peptide drugs avoiding first-pass metabolism. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Red Blood Cell Peptide Delivery
Explore erythrocyte-based carriers for extending peptide circulation time through cellular encapsulation. This peptide or oligopeptide is studied for its bio...
Reduced affinity Ste2p binding
Yeast mating peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
Reduction Cleavable Purification
A purification technique for separating and isolating peptides using Reduction Cleavable. This analytical technique provides valuable insights into peptide s...
RefSeq: Oligopeptide Research Reference
Reference sequence database for genomes, transcripts, and proteins. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Regulatory Harmonization: Oligopeptide Research Reference
Comprehensive reference for Regulatory Harmonization, a peptide compound with applications in research and therapeutics.
Regulatory Science for Peptide Drugs
Emerging regulatory science concepts for evaluating peptide drug products. This peptide or oligopeptide is studied for its biological activity, structure-act...
Relaxin Family Peptides: Oligopeptide Research Reference
Explore relaxin, insulin-like peptides, and their roles in reproduction and tissue remodeling. This peptide or oligopeptide is studied for its biological act...
Relugolix: Oligopeptide Research Reference
Oral GnRH receptor antagonist for prostate cancer and uterine fibroids with rapid suppression. This peptide or oligopeptide is studied for its biological act...
Remifentanil Ultra-Short: Neuropeptide in Neuroscience Re...
Ultra-short-acting opioid with esterase metabolism for surgical anesthesia. This neuropeptide is involved in neurological signaling and is studied for its ro...
Remifentanil: Oligopeptide Research Reference
Remifentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Renal Impairment: Oligopeptide Research Reference
Considerations for peptide drug dosing in patients with kidney disease. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Renin Hormone: Endogenous Peptide Hormone Reference
Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
Renin Inhibitor: Enzyme in Peptide Biology Reference
renin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate specifi...
Renin Peptide Hormone: Endogenous Peptide Hormone Reference
Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
Renin Protein Hormone: Endogenous Peptide Hormone Reference
Renin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sign...
Renin Substrate: Oligopeptide Research Reference
renin substrate in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Renin: Enzyme in Peptide Biology Reference
Aspartyl protease enzyme that cleaves angiotensinogen to angiotensin I, initiating the renin-angiotensin-aldosterone system.
Replica Exchange for Peptides: Comprehensive Peptide Refe...
A computational method for studying peptides using Replica Exchange. This analytical technique provides valuable insights into peptide structure, purity, and...
Reproductive / GnRH Antagonist
Reproductive / GnRH Antagonist is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for it...
Reproductive Endocrinology: Comprehensive Peptide Reference
Reproductive Endocrinology is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bi...
Reproductive Neuropeptides: Comprehensive Peptide Reference
Hypothalamic peptides controlling gonadotropin release and reproductive function. This neuropeptide is involved in neurological signaling and is studied for ...
Research Synthetic: Oligopeptide Research Reference
Cell-penetrating and research peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Resistin Hormone: Endogenous Peptide Hormone Reference
Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Resistin Peptide Hormone: Endogenous Peptide Hormone Refe...
Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Resistin Protein Hormone: Endogenous Peptide Hormone Refe...
Resistin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Resistin: Oligopeptide Research Reference
Resistin is an adipokine that links obesity to insulin resistance and inflammation through AdipoR1 and TLR4 receptor-mediated signaling pathways.
Resolvin D1: Oligopeptide Research Reference
resolvin D1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Resolvin E1: Oligopeptide Research Reference
resolvin E1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
ResPep: Oligopeptide Research Reference
Peptide synthesizer for research-scale SPPS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
response-rate Resource: Oligopeptide Research Reference
The response-rate database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological...
Resveratrol Peptide: Oligopeptide Research Reference
resveratrol peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
RET Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting RET Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Retatrutide: Oligopeptide Research Reference
Triple agonist targeting GLP-1, GIP, and glucagon receptors showing unprecedented weight loss in trials. This peptide or oligopeptide is studied for its biol...
Reverse Phase HPLC (RP-HPLC): Comprehensive Peptide Refer...
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Reversed Phase Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Reversed Phase. This analytical technique provides valuable insights into peptide structure, purity...
RFdiffusion for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using RFdiffusion. This analytical technique provides valuable insights into peptide structure, purity, and char...
RFdiffusion: Oligopeptide Research Reference
High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
Rheumatoid Peptides: Oligopeptide Research Reference
Peptides associated with Rheumatoid including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Rho-GTPase Pathway Peptide 1: Comprehensive Peptide Refer...
A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Rho-GTPase Pathway Peptide 2: Comprehensive Peptide Refer...
A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Rho-GTPase Pathway Peptide 3: Comprehensive Peptide Refer...
A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Rho-GTPase Pathway Peptide 4: Comprehensive Peptide Refer...
A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Rho-GTPase Pathway Peptide 5: Comprehensive Peptide Refer...
A peptide involved in the Rho-GTPase signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
RIA Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using RIA. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Riboswitch: Oligopeptide Research Reference
Comprehensive reference for riboswitch, covering molecular structure, pharmacological properties, receptor interactions,
Ribozyme: Oligopeptide Research Reference
Comprehensive reference for ribozyme, covering molecular structure, pharmacological properties, receptor interactions,
Rice Oryzatin: Oligopeptide Research Reference
rice oryzatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Rice Peptide: Oligopeptide Research Reference
A bioactive peptide derived from rice with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Ricin: Peptide Toxin in Pharmacology Reference
Ricin is a highly toxic heterodimeric ribosome-inactivating protein from castor beans (Ricinus communis) that inhibits protein synthesis through N-glycosidas...
Rift Valley N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Rift Valley N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...
rigidity Resource: Oligopeptide Research Reference
The rigidity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Rilonacept: Oligopeptide Research Reference
rilonacept in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Rimegepant - First-in-Human (NCT01434008)
First-in-human trial of rimegepant for migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Rimegepant - Migraine (NCT03235479)
Phase III trial of rimegepant for acute migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Rimegepant: Oligopeptide Research Reference
Oral CGRP receptor antagonist for both acute migraine treatment and prevention. This peptide or oligopeptide is studied for its biological activity, structur...
Rimorphin: Neuropeptide in Neuroscience Reference
rimorphin is an opioid neuropeptide that modulates pain, reward, and stress responses through opioid receptor activation.
Ring Closing Metathesis Synthesis
A peptide synthesis method using Ring Closing Metathesis for producing peptides with specific properties. This peptide or oligopeptide is studied for its bio...
Risankizumab: Oligopeptide Research Reference
risankizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Risdiplam: Oligopeptide Research Reference
Risdiplam, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Rituximab: Oligopeptide Research Reference
rituximab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
RM-1-MMAE: Oligopeptide Research Reference
RM-1-MMAE, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
RMSD Resource: Oligopeptide Research Reference
The RMSD database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
RNA Conjugation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using RNA Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into p...
RNA interference: Oligopeptide Research Reference
Comprehensive reference for rna interference, covering molecular structure, pharmacological properties, receptor interactions,
RoBERTa for Peptides: Analytical Technique in Peptide Res...
A computational method for studying peptides using RoBERTa. This analytical technique provides valuable insights into peptide structure, purity, and characte...
Romidepsin HDAC Inhibitor: Comprehensive Peptide Reference
Cyclic depsipeptide histone deacetylase inhibitor for cutaneous T-cell lymphoma derived from Chromobacterium violaceum. Covers molecular mechanisms, biologic...
Romidepsin: Oligopeptide Research Reference
Bicyclic depsipeptide histone deacetylase inhibitor from Chromobacterium violaceum used for T-cell lymphoma treatment. Covers molecular mechanisms, biologica...
Romiplostim - ITP (NCT00000129)
Trial of romiplostim for immune thrombocytopenia. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Romiplostim: Oligopeptide Research Reference
Thrombopoietin receptor agonist peptibody for immune thrombocytopenia, stimulating platelet production through TPO receptor activation.
Romosozumab: Oligopeptide Research Reference
Anti-sclerostin monoclonal antibody for osteoporosis stimulating formation and reducing resorption. This peptide or oligopeptide is studied for its biologica...
ROS1 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting ROS1 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
RoseTTAFold for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using RoseTTAFold. This analytical technique provides valuable insights into peptide structure, purity, and char...
RoseTTAFold: Oligopeptide Research Reference
High. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical researc...
rotamer Resource: Oligopeptide Research Reference
The rotamer database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...
Royalisin (Apis): Oligopeptide Research Reference
Royalisin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
RP HPLC Purification: Analytical Technique in Peptide Res...
A purification technique for separating and isolating peptides using RP HPLC. This analytical technique provides valuable insights into peptide structure, pu...
RP-HPLC (Reverse Phase High Performance Liquid Chromatogr...
Comprehensive reference for RP-HPLC (Reverse Phase High Performance Liquid Chromatogr..., a peptide compound with applications in research and therapeutics.
RSV F Protein: Oligopeptide Research Reference
RSV-F-protein is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...
RSV F Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting RSV F for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
RTL1000: Oligopeptide Research Reference
RTL1000, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
RTS,S/AS01 (Mosquirix): Oligopeptide Research Reference
RTS,S/AS01 (Mosquirix), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Rubiscolin 5: Oligopeptide Research Reference
rubiscolin-5 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Rubiscolin 6: Oligopeptide Research Reference
rubiscolin-6 is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Rubiscolin: Oligopeptide Research Reference
Leu-enkephalin analog (Tyr-Gly-Gly-Phe-Leu) derived from spinach RuBisCO enzyme. Has opioid activity at delta-opioid receptors. Found in spinach and other le...
Rye Peptide: Oligopeptide Research Reference
A bioactive peptide derived from rye with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
S Agalactiae Peptide: Oligopeptide Research Reference
A peptide associated with S Agalactiae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...
S Aureus Mrsa Peptide: Oligopeptide Research Reference
A peptide associated with S Aureus Mrsa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
S Aureus Peptide: Oligopeptide Research Reference
A peptide associated with S Aureus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
S Aureus Vrsa Peptide: Oligopeptide Research Reference
A peptide associated with S Aureus Vrsa for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
S Enteritidis Peptide: Oligopeptide Research Reference
A peptide associated with S Enteritidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
S Epidermidis Peptide: Oligopeptide Research Reference
A peptide associated with S Epidermidis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
S Flexneri Peptide: Oligopeptide Research Reference
A peptide associated with S Flexneri for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...
S Mutans Peptide: Oligopeptide Research Reference
A peptide associated with S Mutans for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
S Pneumoniae Peptide: Oligopeptide Research Reference
A peptide associated with S Pneumoniae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structu...
S Sonnei Peptide: Oligopeptide Research Reference
A peptide associated with S Sonnei for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
S Tag Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using S Tag. This analytical technique provides valuable insights into peptide structure, puri...
S Typhi Peptide: Oligopeptide Research Reference
A peptide associated with S Typhi for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-ac...
S Typhimurium Peptide: Oligopeptide Research Reference
A peptide associated with S Typhimurium for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
S Zooepidemicus Peptide: Oligopeptide Research Reference
A peptide associated with S Zooepidemicus for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, stru...
S100B: Oligopeptide Research Reference
92-aa calcium-binding protein (S100B) homodimer. Released by astrocytes upon central nervous system injury. Normal: <0.10 μg/L. Elevated in traumatic brain i...
Sabia N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Sabia N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Saccharomyces cerevisiae: Oligopeptide Research Reference
Farnesylated pheromone binds Ste3p GPCR receptor. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Sacituzumab Govitecan: Oligopeptide Research Reference
Anti-Trop-2 antibody-drug conjugate with SN-38 payload for triple-negative breast cancer and urothelial cancer. Covers molecular mechanisms, biological activ...
Sacituzumab Tirumotecan: Oligopeptide Research Reference
Sacituzumab Tirumotecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sacubitril-Valsartan: Oligopeptide Research Reference
Neprilysin inhibitor combined with ARB for heart failure reducing natriuretic peptide degradation. This peptide or oligopeptide is studied for its biological...
Sacubitril: Oligopeptide Research Reference
Neprilysin inhibitor prodrug that increases natriuretic peptide levels, used with valsartan for heart failure with reduced ejection fraction.
Sacubitril: Oligopeptide Research Reference
Sacubitril is a neprilysin inhibitor prodrug that enhances natriuretic peptide levels, combined with valsartan as Entresto for heart failure with reduced eje...
safety-profile Resource: Oligopeptide Research Reference
The safety-profile database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
SAHB (Stabilized Alpha-Helix of BCL-2 Domains)
Comprehensive reference for SAHB (Stabilized Alpha-Helix of BCL-2 Domains), a peptide compound with applications in research and therapeutics.
Salmon Calcitonin Nasal Spray: Comprehensive Peptide Refe...
Intranasal formulation of synthetic salmon calcitonin for osteoporosis treatment providing bone-protective effects. Covers molecular mechanisms, biological a...
Salmon Calcitonin: Oligopeptide Research Reference
32-amino acid peptide from salmon thyroid C-cells inhibiting osteoclastic bone resorption. This peptide or oligopeptide is studied for its biological activit...
Salmon CGRP: Oligopeptide Research Reference
Salmon CGRP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Salmon GnRH: Oligopeptide Research Reference
Salmon GnRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Salmon Growth Hormone: Oligopeptide Research Reference
Salmon Growth Hormone, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Salmon Insulin: Oligopeptide Research Reference
Salmon Insulin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Salmon Prolactin: Oligopeptide Research Reference
Salmon Prolactin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Salmon Somatolactin: Oligopeptide Research Reference
Salmon Somatolactin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
salt-bridge Resource: Oligopeptide Research Reference
The salt-bridge database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Salting Out Purification: Analytical Technique in Peptide...
A purification technique for separating and isolating peptides using Salting Out. This analytical technique provides valuable insights into peptide structure...
Sample Requirements: Oligopeptide Research Reference
Sample Requirements, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sanger sequencing method, protein primary structure concept
Sanger sequencing method, protein primary structure concept is a bioactive compound with applications in peptide research and therapeutics.
Sanofi: Oligopeptide Research Reference
Lixisenatide. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
SANS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SANS. This analytical technique provides valuable insights into peptide structure, purity, and char...
SANS for Peptides: Analytical Technique in Peptide Research
Application of SANS technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...
Sapecin (Sarcophaga): Oligopeptide Research Reference
Sapecin (Sarcophaga), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sapecin B (Sarcophaga): Oligopeptide Research Reference
Sapecin B (Sarcophaga), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sarafotoxin S6b: Peptide Toxin in Pharmacology Reference
Sarafotoxin S6b, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sarafotoxin: Structure, Function, and Significance
Sarafotoxins are potent vasoconstrictor peptides from burrowing asp venom, structurally similar to endothelins. Covers molecular mechanisms, biological activ...
Sarafoxin: Peptide Toxin in Pharmacology Reference
sarafoxin is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological...
Sarcoidosis Peptides: Oligopeptide Research Reference
Peptides associated with Sarcoidosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
Sarcoma Peptides: Oligopeptide Research Reference
Peptides associated with Sarcoma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biologica...
Sargramostim: Oligopeptide Research Reference
Recombinant GM-CSF myeloid growth factor for neutropenia and stem cell mobilization in transplant settings. This peptide or oligopeptide is studied for its b...
Sargramostim: Oligopeptide Research Reference
Recombinant GM-CSF that stimulates myeloid cell proliferation and function for neutropenia and stem cell mobilization. Covers molecular mechanisms, biologica...
Sarilumab: Oligopeptide Research Reference
sarilumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
SARS CoV 2 RBD Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting SARS CoV 2 RBD for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-...
SARS CoV 2 RBD: Oligopeptide Research Reference
SARS-CoV-2-RBD is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological...
SARS CoV 2 S1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting SARS CoV 2 S1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-a...
SARS CoV 2 S1: Oligopeptide Research Reference
SARS-CoV-2-S1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological ...
SASBDB: Oligopeptide Research Reference
Small Angle Scattering Biological Data Bank for SAXS/SANS data. This peptide or oligopeptide is studied for its biological activity, structure-activity relat...
Saxitoxin: Peptide Toxin in Pharmacology Reference
Saxitoxin is a potent non-peptide neurotoxin produced by dinoflagellates that blocks voltage-gated sodium channels, responsible for paralytic shellfish poiso...
SAXS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SAXS. This analytical technique provides valuable insights into peptide structure, purity, and char...
SAXS for Peptide Structure: Comprehensive Peptide Reference
Understand small-angle X-ray scattering for studying peptide shape, size, and conformational ensembles in solution. Covers molecular mechanisms, biological a...
SAXS for Peptides: Analytical Technique in Peptide Research
Application of SAXS technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights int...
SCF Hormone: Endogenous Peptide Hormone Reference
SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
SCF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting SCF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
SCF Peptide Hormone: Endogenous Peptide Hormone Reference
SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
SCF Protein Hormone: Endogenous Peptide Hormone Reference
SCF, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
scFv antibody: Oligopeptide Research Reference
Comprehensive reference for scfv antibody, covering molecular structure, pharmacological properties, receptor interactions,
ScFv Conjugation Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using ScFv Conjugation for producing peptides with specific properties. This analytical technique provides valuable insights into ...
ScFv System 1: Oligopeptide Research Reference
A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
ScFv System 2: Oligopeptide Research Reference
A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
ScFv System 3: Oligopeptide Research Reference
A scFv-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy. This peptide or oligopeptide is studied for its biologic...
Schistosoma Peptides: Oligopeptide Research Reference
Schistosoma Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Schizophrenia Peptides: Oligopeptide Research Reference
Peptides associated with Schizophrenia including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bio...
Schizophrenia: Oligopeptide Research Reference
Chronic psychiatric disorder affecting ~1% of population. Positive symptoms (hallucinations, delusions, disorganized speech), negative symptoms (flat affect,...
Sciex TripleTOF 6600: Oligopeptide Research Reference
High-resolution mass spectrometer for proteomics and peptidomics. This peptide or oligopeptide is studied for its biological activity, structure-activity rel...
Scleroderma Peptides: Oligopeptide Research Reference
Peptides associated with Scleroderma including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolo...
SCOP Resource: Oligopeptide Research Reference
The SCOP database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its ...
SCOPe Resource: Oligopeptide Research Reference
The SCOPe database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its...
Scorpaenotoxin: Oligopeptide Research Reference
Scorpaenotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Scorpion Anticancer Peptides: Comprehensive Peptide Refer...
Scorpion-derived peptides with selective anticancer activity. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanis...
Scorpion Cardiovascular Effects
Cardiovascular effects of scorpion venom including arrhythmias and hypertension. This peptide toxin is derived from venom and studied for its pharmacological...
Scorpion Chlorotoxin: Peptide Toxin in Pharmacology Refer...
Scorpion venom peptide binding matrix metalloproteinase-2 on glioma cells. This peptide toxin is derived from venom and studied for its pharmacological activ...
Scorpion Neurotoxicity: Peptide Toxin in Pharmacology Ref...
Mechanisms of scorpion neurotoxicity through sodium and potassium channel modulation. This peptide toxin is derived from venom and studied for its pharmacolo...
Scorpion Toxin Classification: Comprehensive Peptide Refe...
Classification of scorpion toxins by target specificity and structure. This peptide toxin is derived from venom and studied for its pharmacological activity,...
Scorpion Toxin Kv1.3 Therapy: Comprehensive Peptide Refer...
Therapeutic potential of Kv1.3-blocking scorpion toxins for autoimmune diseases. This peptide toxin is derived from venom and studied for its pharmacological...
Scorpion Toxin Research Tools: Comprehensive Peptide Refe...
Use of scorpion toxins as pharmacological research tools. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of...
Scorpion Venom AMPs: Peptide Toxin in Pharmacology Reference
Antimicrobial peptides from scorpion venom with broad-spectrum bactericidal activity. This peptide toxin is derived from venom and studied for its pharmacolo...
Scorpion Venom Immunomodulation
Immunomodulatory properties of scorpion venom components for therapeutic development. This peptide toxin is derived from venom and studied for its pharmacolo...
Scorpion Venoms: Peptide Toxin in Pharmacology Reference
K+, Nav, Cl-, glioma. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications ...
Scorpion: Peptide Toxin in Pharmacology Reference
~4.0 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in researc...
SDS PAGE Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SDS PAGE. This analytical technique provides valuable insights into peptide structure, purity, and ...
SDS-PAGE for Peptides: Analytical Technique in Peptide Re...
Guide to SDS-polyacrylamide gel electrophoresis for separating peptides by molecular weight and assessing purity. Covers molecular mechanisms, biological act...
Sea Anemone Cytolytic Peptides
Cytolytic peptides from sea anemone causing cell membrane disruption. This peptide toxin is derived from venom and studied for its pharmacological activity, ...
Sea Anemone Kv1 Blocker: Peptide Toxin in Pharmacology Re...
Potassium channel blocker from sea anemone with neuroprotective potential. This peptide toxin is derived from venom and studied for its pharmacological activ...
Sea Anemone Neurotoxicity: Comprehensive Peptide Reference
Neurotoxic mechanisms of sea anemone venoms on nervous system. This peptide toxin is derived from venom and studied for its pharmacological activity, mechani...
Sea Anemone Toxin Anti-Inflammatory
Anti-inflammatory properties of sea anemone toxins. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of actio...
Sea Anemone Toxin ATX-I: Peptide Toxin in Pharmacology Re...
Sodium channel inactivating peptide from Anemonia sulcata. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism o...
Sea Anemone Toxin ATX-II: Peptide Toxin in Pharmacology R...
Sodium channel modulator from Anemonia sulcata with cardiotoxic effects. This peptide toxin is derived from venom and studied for its pharmacological activit...
Sea Anemone Toxin Cardiac: Comprehensive Peptide Reference
Cardiac effects and therapeutic potential of sea anemone toxins. This peptide toxin is derived from venom and studied for its pharmacological activity, mecha...
Sea Anemone Toxin Mechanism: Comprehensive Peptide Reference
Mechanisms of sea anemone toxin action on ion channels. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of a...
SEC (Size Exclusion Chromatography)
Comprehensive reference for SEC (Size Exclusion Chromatography), a peptide compound with applications in research and therapeutics.
SEC HPLC Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using SEC HPLC. This analytical technique provides valuable insights into peptide structure, p...
SEC MALS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SEC MALS. This analytical technique provides valuable insights into peptide structure, purity, and ...
SEC Purification: Analytical Technique in Peptide Research
A purification technique for separating and isolating peptides using SEC. This analytical technique provides valuable insights into peptide structure, purity...
secondary-endpoint Resource: Comprehensive Peptide Reference
The secondary-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
Secretin 1-10: Peptide Fragment Reference
Comprehensive reference for secretin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 1-14: Peptide Fragment Reference
Comprehensive reference for secretin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 1-27: Peptide Fragment Reference
Comprehensive reference for secretin 1-27 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 1-4: Peptide Fragment Reference
Comprehensive reference for secretin 1-4 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 1-6: Peptide Fragment Reference
Comprehensive reference for secretin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 1-8: Peptide Fragment Reference
Comprehensive reference for secretin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 14-27: Peptide Fragment Reference
Comprehensive reference for secretin 14-27 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 20-27: Peptide Fragment Reference
Comprehensive reference for secretin 20-27 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin 8-27: Peptide Fragment Reference
Comprehensive reference for secretin 8-27 variant, covering molecular structure, pharmacological properties, receptor interactions,
Secretin Family Peptides: Oligopeptide Research Reference
Overview of secretin family peptides including secretin, VIP, PACAP, and GIP in gastrointestinal function. This peptide or oligopeptide is studied for its bi...
Secretin Hormone: Endogenous Peptide Hormone Reference
Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Secretin Peptide Hormone: Endogenous Peptide Hormone Refe...
Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Secretin Protein Hormone: Endogenous Peptide Hormone Refe...
Secretin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Secretin: Endogenous Peptide Hormone Reference
27-amino acid gut hormone that stimulates pancreatic bicarbonate secretion and regulates gastric acid output. This peptide or oligopeptide is studied for its...
Secukinumab: Oligopeptide Research Reference
secukinumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Seed amplification assay: Oligopeptide Research Reference
Alpha-synuclein (PD). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bi...
selectivity Resource: Oligopeptide Research Reference
The selectivity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Selenium Peptide: Oligopeptide Research Reference
selenium peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Self Assembling Synthesis: Comprehensive Peptide Reference
A peptide synthesis method using Self Assembling for producing peptides with specific properties. This analytical technique provides valuable insights into p...
Self Attention for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Self Attention. This analytical technique provides valuable insights into peptide structure, purity, and c...
Self-assembling peptides, biosensors, green chemistry
Metric. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...
self-assembly for Peptides: Comprehensive Peptide Reference
Application of self-assembly technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its...
Self-Emulsifying Peptide Delivery
Discover SEDDS formulations for enhancing oral bioavailability of lipophilic peptide drugs. This peptide or oligopeptide is studied for its biological activi...
Semaglutide (Oral): Oligopeptide Research Reference
Semaglutide (Oral), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Semaglutide 2.4mg Obesity: Comprehensive Peptide Reference
Higher-dose semaglutide approved for chronic weight management in adults with obesity. This peptide or oligopeptide is studied for its biological activity, s...
Semaglutide 3-Month Dosing: Comprehensive Peptide Reference
Extended dosing interval option for semaglutide allowing three-month intervals between injections. This peptide or oligopeptide is studied for its biological...
Semaglutide Insulin Coformulation
Experimental co-formulation of semaglutide with ultra-long-acting insulin for single-injection therapy. This peptide or oligopeptide is studied for its biolo...
Semaglutide vs Tirzepatide: Comprehensive Peptide Reference
Comparative pharmacological analysis of semaglutide (GLP-1 RA) and tirzepatide (dual GIP/GLP-1 agonist) in the treatment of obesity and type 2 diabetes mellitus
Semaglutide: Oligopeptide Research Reference
semaglutide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Semaglutide: Therapeutic Peptide Drug Profile
A long-acting glucagon-like peptide-1 (GLP-1) receptor agonist used for type 2 diabetes and obesity treatment, featuring Aib8 substitution and C-18 fatty dia...
Semaphorin 3A Inhibitor: Oligopeptide Research Reference
semaphorin 3A inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Semi Empirical for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Semi Empirical. This analytical technique provides valuable insights into peptide structure, purity, and c...
Semorinemab: Oligopeptide Research Reference
Semorinemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
sensitivity Resource: Oligopeptide Research Reference
The sensitivity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
Sepsis and Peptides: Oligopeptide Research Reference
Explore antimicrobial and immunomodulatory peptides for managing sepsis and systemic inflammatory responses. This peptide or oligopeptide is studied for its ...
Sepsis: Oligopeptide Research Reference
Sepsis, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sericin (Bombyx): Oligopeptide Research Reference
Sericin (Bombyx), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Serine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Serine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...
Serine Modification: Post-Translational Modification Refe...
Post-translational modifications of Serine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...
Serine Peptide: Oligopeptide Research Reference
Serine (S) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...
Serine protease involved in egress from RBCs
Protozoan peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
serious-adverse-event Resource
The serious-adverse-event database or resource for peptide research, providing data on structure, function, and interactions.
Sermorelin: Oligopeptide Research Reference
Synthetic GHRH(1-29) analog for GH stimulation testing and potential deficiency treatment. This peptide or oligopeptide is studied for its biological activit...
Sesame Peptide: Oligopeptide Research Reference
A bioactive peptide derived from sesame with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Shallot Peptide: Oligopeptide Research Reference
A bioactive peptide derived from shallot with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
shape-complementarity Resource
The shape-complementarity database or resource for peptide research, providing data on structure, function, and interactions.
Sheep Cathelicidin SMAP-29: Comprehensive Peptide Reference
Potent cathelicidin from sheep neutrophils with activity against resistant bacteria. This antimicrobial peptide demonstrates activity against pathogens and i...
Sheep Cathelicidin: Oligopeptide Research Reference
Sheep Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sheet Assembly System 1: Oligopeptide Research Reference
A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Sheet Assembly System 2: Oligopeptide Research Reference
A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Sheet Assembly System 3: Oligopeptide Research Reference
A sheet-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Shell Matrix Peptides: Oligopeptide Research Reference
Shell Matrix Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Shimadzu Prominence: Oligopeptide Research Reference
HPLC system for analytical and preparative peptide purification. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
ShK (Stichodactyla helianthus K+ channel toxin)
Comprehensive reference for ShK (Stichodactyla helianthus K+ channel toxin), a peptide compound with applications in research and therapeutics.
ShK: Peptide Toxin in Pharmacology Reference
ShK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Shrimp Antimicrobial Peptides: Comprehensive Peptide Refe...
AMPs in shrimp hemocytes defending against aquaculture pathogens. This antimicrobial peptide demonstrates activity against pathogens and is studied for its m...
Side Chain Cyclization (Disulfide)
Formation of disulfide bond between two cysteine residues. Stabilizes structure. This peptide or oligopeptide is studied for its biological activity, structu...
Side Chain Cyclization (Lactam)
Formation of lactam bridge between side chain functional groups. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Side Chain Mod System 1: Oligopeptide Research Reference
A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Side Chain Mod System 2: Oligopeptide Research Reference
A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Side Chain Mod System 3: Oligopeptide Research Reference
A side-chain-mod-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challe...
Side Chain: Post-Translational Modification Reference
Transient. This modification affects peptide stability, receptor binding, and biological activity, playing an important role in the design of optimized thera...
Sigma Conotoxin GVIA: Peptide Toxin in Pharmacology Refer...
sigma-conotoxin-GVIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Sigma-Conotoxin MrIA: Peptide Toxin in Pharmacology Refer...
Serotonin transporter inhibitor from Conus marmoreus with antidepressant potential. This peptide toxin is derived from venom and studied for its pharmacologi...
Signal transduction: Oligopeptide Research Reference
Comprehensive reference for signal transduction, covering molecular structure, pharmacological properties, receptor interactions,
Signaling Peptides: Oligopeptide Research Reference
Quorum sensing modulation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
Silica Nanoparticle Labeling Synthesis
A peptide synthesis method using Silica Nanoparticle Labeling for producing peptides with specific properties. This peptide or oligopeptide is studied for it...
Silk Elastin Copolymer: Oligopeptide Research Reference
silk elastin copolymer in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Silk Fibroin: Oligopeptide Research Reference
The main structural protein of silk, composed of repetitive GAGAGS sequences that form beta-sheet crystalline structures, with applications in biomedical eng...
Silk Protein / Structural: Comprehensive Peptide Reference
Silk Protein / Structural is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its bio...
Silk Proteins: Oligopeptide Research Reference
Structural, biomaterial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
SIMS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SIMS. This analytical technique provides valuable insights into peptide structure, purity, and char...
Single molecule array: Oligopeptide Research Reference
Ultra-sensitive (neuro). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in...
Single-domain antibody: Oligopeptide Research Reference
Comprehensive reference for single-domain antibody, covering molecular structure, pharmacological properties, receptor interactions,
siRNA delivery: Oligopeptide Research Reference
Comprehensive reference for sirna delivery, covering molecular structure, pharmacological properties, receptor interactions,
SiRNA System 1: Oligopeptide Research Reference
A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
SiRNA System 2: Oligopeptide Research Reference
A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
SiRNA System 3: Oligopeptide Research Reference
A siRNA-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in p...
Sirolimus: Oligopeptide Research Reference
Macrolide immunosuppressant that inhibits mTOR to block T-cell proliferation in transplant rejection and coronary stent coatings.
SIRP Alpha Antagonist: Oligopeptide Research Reference
SIRP alpha antagonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Size Exclusion Analysis: Analytical Technique in Peptide ...
An analytical technique for characterizing peptides using Size Exclusion. This analytical technique provides valuable insights into peptide structure, purity...
Size Exclusion Chromatography (SEC)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Skin AMP Cocktail: Antimicrobial Peptide Reference
Combination of dermcidin, defensins, and cathelicidin on skin surface. This antimicrobial peptide demonstrates activity against pathogens and is studied for ...
Skin Brightening: Oligopeptide Research Reference
Peptide-based skin brightening approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Skin Disease and Peptides: Comprehensive Peptide Reference
Learn about cosmetic and therapeutic peptides for skin conditions including psoriasis, eczema, and aging. This peptide or oligopeptide is studied for its bio...
Sleep / Neurological: Oligopeptide Research Reference
Sleep / Neurological is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologic...
Sleep-Wake Neuropeptides: Neuropeptide in Neuroscience Re...
Neuropeptides regulating circadian rhythms and sleep-wake transitions. This neuropeptide is involved in neurological signaling and is studied for its roles i...
Slit 2 Inhibitor: Oligopeptide Research Reference
slit 2 inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
SMAP 34: Antimicrobial Peptide Reference
SMAP-34 is a cathelicidin antimicrobial peptide with broad-spectrum activity against bacteria, fungi, and viruses. Covers molecular mechanisms, biological ac...
SMAP-29: Oligopeptide Research Reference
SMAP-29, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
SMART Resource: Oligopeptide Research Reference
The SMART database or resource for peptide research, providing data on structure, function, and interactions. This peptide or oligopeptide is studied for its...
Smart Responsive Peptide Delivery
Discover stimuli-responsive delivery systems that release peptides in response to pH, temperature, or enzymes. This peptide or oligopeptide is studied for it...
Snake Venom Peptides: Oligopeptide Research Reference
Neurology, Cardiovascular, Research Tools. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Snake Venoms: Peptide Toxin in Pharmacology Reference
nAChR, Nav, PLA2, K+, ET receptors. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential...
Snake: Peptide Toxin in Pharmacology Reference
0.03 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in researc...
Snakin: Oligopeptide Research Reference
Snakin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
SNAP-8: Oligopeptide Research Reference
Acetyl octapeptide-3 (Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala). Extended analog of Argireline with additional alanine residue. Inhibits SNARE complex formation. Anti-...
So-D1: Oligopeptide Research Reference
So-D1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Social Behavior Neuropeptides: Comprehensive Peptide Refe...
Neuropeptides mediating social bonding, recognition, and interaction. This neuropeptide is involved in neurological signaling and is studied for its roles in...
Soil Health: Oligopeptide Research Reference
Use of antimicrobial peptides for soil health. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pot...
sol for Peptides: Analytical Technique in Peptide Research
Application of sol technique for peptide characterization, structure determination, or formulation. This analytical technique provides valuable insights into...
Solenopsin (Solenopsis): Oligopeptide Research Reference
Solenopsin (Solenopsis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Solid Lipid Nanoparticles Peptide
Solid lipid nanoparticles for controlled peptide release and protection. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Solid Phase Peptide Synthesis (SPPS)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Solid Phase Synthesis: Analytical Technique in Peptide Re...
A peptide synthesis method using Solid Phase for producing peptides with specific properties. This analytical technique provides valuable insights into pepti...
Solid-Phase Peptide Synthesis: Comprehensive Peptide Refe...
Comprehensive resource on SPPS methods and applications. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Soliqua/Suliqua Co-Formulation Technology
Dual-chamber pen device technology enabling stable co-formulation of insulin glargine and lixisenatide. This peptide or oligopeptide is studied for its biolo...
Solithromycin: Oligopeptide Research Reference
Solithromycin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
solvent-accessible Resource: Comprehensive Peptide Reference
The solvent-accessible database or resource for peptide research, providing data on structure, function, and interactions.
Somapacitan: Oligopeptide Research Reference
Long-acting growth hormone albumin-binding prodrug for once-weekly dosing. This peptide or oligopeptide is studied for its biological activity, structure-act...
Somatostatin → SSTR2: Oligopeptide Research Reference
Somatostatin → SSTR2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Somatostatin 1-10: Peptide Fragment Reference
Comprehensive reference for somatostatin 1-10 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 1-12: Peptide Fragment Reference
Comprehensive reference for somatostatin 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 1-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 1-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 1-28: Peptide Fragment Reference
Comprehensive reference for somatostatin 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 1-8: Peptide Fragment Reference
Comprehensive reference for somatostatin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 11-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 11-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 13-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 13-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 5-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 5-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 7-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 7-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin 9-14: Peptide Fragment Reference
Comprehensive reference for somatostatin 9-14 variant, covering molecular structure, pharmacological properties, receptor interactions,
Somatostatin Analog: Oligopeptide Research Reference
somatostatin analog in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Somatostatin Analog: Oligopeptide Research Reference
Somatostatin Analog is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biologica...
Somatostatin Central: Neuropeptide in Neuroscience Reference
Hypothalamic and GI peptide inhibiting growth hormone and multiple secretory functions. This neuropeptide is involved in neurological signaling and is studie...
Somatostatin Family Peptides: Comprehensive Peptide Refer...
Learn about somatostatin and cortistatin peptides in hormone inhibition and neuromodulation. This endogenous peptide hormone plays important roles in physiol...
Somatostatin Hormone: Endogenous Peptide Hormone Reference
Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Somatostatin Peptide Hormone: Comprehensive Peptide Refer...
Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Somatostatin Protein Hormone: Comprehensive Peptide Refer...
Somatostatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Somatostatin-14: Neuropeptide in Neuroscience Reference
Somatostatin-14, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Somatostatin: Oligopeptide Research Reference
A 14-amino acid cyclic neuropeptide that inhibits growth hormone release, modulates GI function, and serves as the prototype for long-acting analogs like oct...
Somatropin: Oligopeptide Research Reference
somatropin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Somatropin: Oligopeptide Research Reference
Recombinant human growth hormone identical to endogenous 191 amino acid pituitary GH. This peptide or oligopeptide is studied for its biological activity, st...
Sonochemical Synthesis: Analytical Technique in Peptide R...
A peptide synthesis method using Sonochemical for producing peptides with specific properties. This analytical technique provides valuable insights into pept...
Sonophoresis Peptide Delivery: Comprehensive Peptide Refe...
Discover ultrasound-mediated transdermal peptide delivery using cavitation and acoustic streaming effects. This peptide or oligopeptide is studied for its bi...
Sorghum Peptide: Oligopeptide Research Reference
A bioactive peptide derived from sorghum with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Soy Lunasin: Oligopeptide Research Reference
soy lunasin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Soy Peptide: Oligopeptide Research Reference
A bioactive peptide derived from soy with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activity ...
Soy Soystatin: Oligopeptide Research Reference
soy soystatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Soyacystatin: Oligopeptide Research Reference
Soyacystatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Soymilk Peptide: Oligopeptide Research Reference
soymilk-peptide is a bioactive peptide with potential health benefits including antihypertensive, antioxidant, or neuroprotective properties.
Soymorphin-5: Oligopeptide Research Reference
Met-enkephalin analog derived from soy β-conglycinin. Opioid activity. Found in soy protein digests. May contribute to neuroactive effects of soy consumption.
Soystatin: Structure, Function, and Significance
Soystatin is an ACE-inhibitory peptide from soy protein hydrolysates with antihypertensive activity. This peptide or oligopeptide is studied for its biologic...
Special Populations: Oligopeptide Research Reference
Dose adjustment required. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
specificity Resource: Oligopeptide Research Reference
The specificity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological a...
spectroscopy for Peptides: Comprehensive Peptide Reference
Application of spectroscopy technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...
Spexin: Neuropeptide in Neuroscience Reference
Novel neuropeptide with anorexigenic and GI motility effects. This neuropeptide is involved in neurological signaling and is studied for its roles in brain f...
Spider Anticancer Peptides: Comprehensive Peptide Reference
Spider venom peptides with selective toxicity against cancer cells. This peptide toxin is derived from venom and studied for its pharmacological activity, me...
Spider Toxin Ca2+ Channel Modulators
Calcium channel modulating peptides from spider venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of ac...
Spider Toxin CNS Targets: Peptide Toxin in Pharmacology R...
Spider venom peptides targeting central nervous system ion channels. This peptide toxin is derived from venom and studied for its pharmacological activity, m...
Spider Toxin Diversity: Peptide Toxin in Pharmacology Ref...
Diversity of spider venom peptides and their pharmacological targets. This peptide toxin is derived from venom and studied for its pharmacological activity, ...
Spider Toxin HNTX-I: Peptide Toxin in Pharmacology Reference
TRPV1 antagonist from Chinese bird spider with analgesic potential. This peptide toxin is derived from venom and studied for its pharmacological activity, me...
Spider Toxin Insecticidal: Comprehensive Peptide Reference
Insecticidal spider venom peptides for pest control applications. This peptide toxin is derived from venom and studied for its pharmacological activity, mech...
Spider Toxin Ion Channel Studies
Use of spider toxins as tools to study ion channel function. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism...
Spider Toxin JZTX-I: Peptide Toxin in Pharmacology Reference
Sodium channel modulator from Jinzo spider affecting neuronal excitability. This peptide toxin is derived from venom and studied for its pharmacological acti...
Spider Toxin K+ Channel Blockers
Potassium channel blocking peptides from spider venom for neurological research. This peptide toxin is derived from venom and studied for its pharmacological...
Spider Toxin PhTx3: Peptide Toxin in Pharmacology Reference
Potent glutamate receptor antagonist from Phoneutria nigriventer for pain. This peptide toxin is derived from venom and studied for its pharmacological activ...
Spider Venom AMPs: Peptide Toxin in Pharmacology Reference
AMPs from spider venom with activity against bacteria and fungi. This peptide toxin is derived from venom and studied for its pharmacological activity, mecha...
Spider Venoms: Peptide Toxin in Pharmacology Reference
Cav, Nav, K+, glutamate, nAChR. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential app...
Spider: Peptide Toxin in Pharmacology Reference
~0.05 mg/kg. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of action, and potential applications in resear...
Spidroin I (Nephila): Oligopeptide Research Reference
Spidroin I (Nephila), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Spidroin II (Nephila): Oligopeptide Research Reference
Spidroin II (Nephila), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Spinach Peptide: Oligopeptide Research Reference
A bioactive peptide derived from spinach with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Spinning Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Spinning for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...
Spodoptericin (Spodoptera): Comprehensive Peptide Reference
Comprehensive reference for Spodoptericin (Spodoptera), a peptide compound with applications in research and therapeutics.
SPPS (1963), Fmoc chemistry development
SPPS (1963), Fmoc chemistry development is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biologic...
SPPS (Solid Phase Peptide Synthesis)
Comprehensive reference for SPPS (Solid Phase Peptide Synthesis), a peptide compound with applications in research and therapeutics.
SPPS Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using SPPS for producing peptides with specific properties. This analytical technique provides valuable insights into peptide stru...
SPR Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using SPR. This analytical technique provides valuable insights into peptide structure, purity, and chara...
SPR for Peptide Binding: Analytical Technique in Peptide ...
Explore surface plasmon resonance for real-time measurement of peptide binding kinetics and affinity interactions. Covers molecular mechanisms, biological ac...
Spray Drying Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Spray Drying. This analytical technique provides valuable insights into peptide structur...
Spray Drying: Oligopeptide Research Reference
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
spray-drying for Peptides: Comprehensive Peptide Reference
Application of spray-drying technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its ...
Squash Peptide: Oligopeptide Research Reference
A bioactive peptide derived from squash with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
SRC Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting SRC Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Src Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Src Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Src Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Src Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Src Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the Src signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
stability Resource: Oligopeptide Research Reference
The stability database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological act...
Stability Testing for Peptides
Guide to stability testing protocols and ICH conditions for establishing peptide drug shelf life and storage conditions.
Stability Testing: Oligopeptide Research Reference
Stability Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
stable-disease Resource: Oligopeptide Research Reference
The stable-disease database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Stamping Synthesis: Analytical Technique in Peptide Research
A peptide synthesis method using Stamping for producing peptides with specific properties. This analytical technique provides valuable insights into peptide ...
Stapled Peptide: Oligopeptide Research Reference
Stapled Peptide is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological ac...
Stapled Peptides in Cancer: Comprehensive Peptide Reference
An overview of hydrocarbon stapled peptides as cancer therapeutics, covering MDM2/MDMX inhibition, BCL-2 family targeting, and ALRN-6924 clinical development.
Stapled Peptides: Oligopeptide Research Reference
Alpha-helix stabilized peptides for PPI inhibition. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, an...
Stapled System 1: Oligopeptide Research Reference
A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Stapled System 2: Oligopeptide Research Reference
A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Stapled System 3: Oligopeptide Research Reference
A stapled-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges in...
Stapling System 1: Oligopeptide Research Reference
A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Stapling System 2: Oligopeptide Research Reference
A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Stapling System 3: Oligopeptide Research Reference
A stapling-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
STAT Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting STAT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
Steered MD for Peptides: Analytical Technique in Peptide ...
A computational method for studying peptides using Steered MD. This analytical technique provides valuable insights into peptide structure, purity, and chara...
Stentor coeruleus: Oligopeptide Research Reference
Photosensitizer, generates singlet oxygen. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Sterility Testing (Microbial Limits)
>. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research a...
Sterility Testing: Oligopeptide Research Reference
Sterility Testing, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Stevioside: Oligopeptide Research Reference
stevioside in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
STING Peptide Conjugates: Oligopeptide Research Reference
Comprehensive reference for STING Peptide Conjugates, a peptide compound with applications in research and therapeutics.
Stonustoxin: Oligopeptide Research Reference
Stonustoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Strained Alkyne Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Strained Alkyne. This analytical technique provides valuable insights into peptide struc...
Strawberry Peptide: Oligopeptide Research Reference
A bioactive peptide derived from strawberry with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Streptavidin Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Streptavidin. This analytical technique provides valuable insights into peptide structur...
Stress Response Peptides: Neuropeptide in Neuroscience Re...
Neuropeptides coordinating hypothalamic-pituitary-adrenal stress response. This neuropeptide is involved in neurological signaling and is studied for its rol...
Stroke Peptides: Oligopeptide Research Reference
Peptides associated with Stroke including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological...
Stroke: Oligopeptide Research Reference
Cerebrovascular accident. Ischemic (85%) or hemorrhagic (15%). This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Subcutaneous Peptide Delivery: Comprehensive Peptide Refe...
Understand subcutaneous injection methods for sustained peptide drug delivery including depot formulations. This peptide or oligopeptide is studied for its b...
Sublingual Peptide Delivery: Comprehensive Peptide Reference
Sublingual administration for rapid systemic peptide absorption. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Substance K: Neuropeptide in Neuroscience Reference
Substance K is a tachykinin neuropeptide that activates NK2 receptors to mediate smooth muscle contraction and inflammatory responses in mammalian tissues.
Substance P → ACE (Substrate): Comprehensive Peptide Refe...
Comprehensive reference for Substance P → ACE (Substrate), a peptide compound with applications in research and therapeutics.
Substance P: Neuropeptide in Neuroscience Reference
An undecapeptide neuropeptide of the tachykinin family that functions as a neurotransmitter and neuromodulator in the central and peripheral nervous systems,...
Subtilin: Antimicrobial Peptide Reference
subtilin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...
Sufentanil Synthetic Opioid: Comprehensive Peptide Reference
Potent synthetic opioid with greater mu-selectivity than fentanyl. This neuropeptide is involved in neurological signaling and is studied for its roles in br...
Sufentanil: Oligopeptide Research Reference
Sufentanil, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Sulodexide: Oligopeptide Research Reference
Glycosaminoglycan mixture of heparan sulfate and dermatan sulfate for diabetic nephropathy. This peptide or oligopeptide is studied for its biological activi...
SUMO Tag Purification: Analytical Technique in Peptide Re...
A purification technique for separating and isolating peptides using SUMO Tag. This analytical technique provides valuable insights into peptide structure, p...
Sun Protection: Oligopeptide Research Reference
Peptide-based UV protection approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Sunflower Peptide: Oligopeptide Research Reference
A bioactive peptide derived from sunflower with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-act...
Sunvozertinib: Oligopeptide Research Reference
Sunvozertinib, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Superoxide Dismutase Mn: Oligopeptide Research Reference
superoxide dismutase mn in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
supramolecular for Peptides: Comprehensive Peptide Reference
Application of supramolecular technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Surface Modification Synthesis
A peptide synthesis method using Surface Modification for producing peptides with specific properties. This peptide or oligopeptide is studied for its biolog...
Surface-Enhanced Raman for Peptides
Explore SERS techniques for ultrasensitive peptide detection using metallic nanostructure signal enhancement. This peptide or oligopeptide is studied for its...
surface-exposure Resource: Comprehensive Peptide Reference
The surface-exposure database or resource for peptide research, providing data on structure, function, and interactions.
surface-plasmon-resonance for Peptides
Application of surface-plasmon-resonance technique for peptide characterization, structure determination, or formulation.
surrogate-endpoint Resource: Comprehensive Peptide Reference
The surrogate-endpoint database or resource for peptide research, providing data on structure, function, and interactions.
Suruvatide: Oligopeptide Research Reference
Suruvatide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
survival Resource: Oligopeptide Research Reference
The survival database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Survivin Peptide: Oligopeptide Research Reference
survivin peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Survodutide: Oligopeptide Research Reference
Dual glucagon/GLP-1 receptor agonist for obesity and metabolic dysfunction-associated steatohepatitis. This peptide or oligopeptide is studied for its biolog...
SYN-001: Oligopeptide Research Reference
Industry standard, automated. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicatio...
SYN-002: Oligopeptide Research Reference
Large scale, solution phase. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
SYN-003: Oligopeptide Research Reference
Complex proteins, PTMs. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
SYN-004: Oligopeptide Research Reference
Non-natural AAs, rapid. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in ...
SYN-005: Oligopeptide Research Reference
Green chemistry, stereocontrol. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
SYN-006: Oligopeptide Research Reference
Fast, difficult sequences. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
SYN-007: Oligopeptide Research Reference
Continuous, PAT integration. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
SYN-008: Oligopeptide Research Reference
Long peptides, convergent. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications ...
SYN-009: Oligopeptide Research Reference
Proteins, chemoselective. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
SYN-010: Oligopeptide Research Reference
Conjugation, bioconjugation. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential application...
Syn-Ake: Oligopeptide Research Reference
Diaminobutyryl benzylamide. Synthetic tripeptide mimicking Waglerin-1 from temple viper (Tropidolaemus wagleri) venom. Competitively blocks nicotinic acetylc...
Syn-Hycan: Oligopeptide Research Reference
Acetyl hexapeptide-30. Inhibits acetylcholine release at neuromuscular junction. Reduces muscle contractions. Used in anti-aging skincare.
Syn-Tacks: Oligopeptide Research Reference
Acetyl hexapeptide-38. Inhibits neurotransmitter release. Reduces expression lines. Used in cosmetic formulations. Covers molecular mechanisms, biological ac...
Synthesis (10 processes): Oligopeptide Research Reference
Comprehensive reference for Synthesis (10 processes), a peptide compound with applications in research and therapeutics.
Synthesis Technologies: Oligopeptide Research Reference
Methods for peptide bond formation and assembly. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Synthesis Technology Comparison
Comparison of different peptide synthesis technologies. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships...
Synthetase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Synthetase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-act...
Synthetic Defensin Mimetics: Comprehensive Peptide Reference
Rationally designed synthetic peptides mimicking defensin structure and function. This antimicrobial peptide demonstrates activity against pathogens and is s...
Systemin: Oligopeptide Research Reference
Systemin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
T Pallidum Peptide: Oligopeptide Research Reference
A peptide associated with T Pallidum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...
T SNE for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using T SNE. This analytical technique provides valuable insights into peptide structure, purity, and characteri...
T-cerulein: Antimicrobial Peptide Reference
T-cerulein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
T-Kinin: Antimicrobial Peptide Reference
T-Kinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
T5 for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using T5. This analytical technique provides valuable insights into peptide structure, purity, and characterizat...
Tachykinin Family Peptides: Comprehensive Peptide Reference
Guide to substance P, neurokinin A, and neurokinin B in pain transmission and neuroinflammation. This peptide or oligopeptide is studied for its biological a...
Tachykinin Like: Peptide Toxin in Pharmacology Reference
tachykinin-like is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide toxin is derived from venom and studied for ...
Tachyplesin: Antimicrobial Peptide Reference
AMP from horseshoe crab hemocytes with beta-sheet structure and membrane-disrupting activity. This antimicrobial peptide demonstrates activity against pathog...
Tachystatin: Antimicrobial Peptide Reference
Chitin-binding antimicrobial protein from horseshoe crab providing innate defense against fungi. This antimicrobial peptide demonstrates activity against pat...
Tacrolimus: Oligopeptide Research Reference
Macrolide calcineurin inhibitor from Streptomyces tsukubaensis used as an immunosuppressant in organ transplantation and atopic dermatitis.
Taenia Peptides: Oligopeptide Research Reference
Taenia Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Taipoxin: Peptide Toxin in Pharmacology Reference
Taipoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tamiami N Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Tamiami N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activ...
TAP: Oligopeptide Research Reference
TAP, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tapentadol Dual Mechanism: Comprehensive Peptide Reference
Opioid agonist and norepinephrine reuptake inhibitor for moderate to severe pain. This neuropeptide is involved in neurological signaling and is studied for ...
Targeted delivery: Oligopeptide Research Reference
Comprehensive reference for targeted delivery, covering molecular structure, pharmacological properties, receptor interactions,
Targeted System 1: Oligopeptide Research Reference
A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Targeted System 2: Oligopeptide Research Reference
A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Targeted System 3: Oligopeptide Research Reference
A targeted-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
TAT Peptide (47-57): Oligopeptide Research Reference
TAT Peptide (47-57), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tau (Phosphorylated): Oligopeptide Research Reference
Hyperphosphorylated tau. Neurofibrillary tangles in Alzheimer's disease. This peptide or oligopeptide is studied for its biological activity, structure-activ...
Tau Aggregation (Self-association)
Comprehensive reference for Tau Aggregation (Self-association), a peptide compound with applications in research and therapeutics.
Tau aggregation: Oligopeptide Research Reference
Comprehensive reference for tau aggregation, covering molecular structure, pharmacological properties, receptor interactions,
Tau Conotoxin TxVIIA: Peptide Toxin in Pharmacology Refer...
tau-conotoxin-TxVIIA is a conotoxin from cone snail venom with specific ion channel blocking properties. This peptide or oligopeptide is studied for its biol...
Tau Phosphorylated: Oligopeptide Research Reference
tau phosphorylated in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
TB Ag85A Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting TB Ag85A for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
TB Ag85A: Oligopeptide Research Reference
TB-Ag85A is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activ...
TB MPT64 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting TB MPT64 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
TB MPT64: Oligopeptide Research Reference
TB-MPT64 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biological activ...
TCA Precipitation Purification
A purification technique for separating and isolating peptides using TCA Precipitation. This analytical technique provides valuable insights into peptide str...
TCGA: Oligopeptide Research Reference
The Cancer Genome Atlas for cancer genomics data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Teduglutide: Oligopeptide Research Reference
GLP-2 analog resistant to DPP-4 degradation for short bowel syndrome, reducing parenteral nutrition dependence. Covers molecular mechanisms, biological activ...
Teicoplanin: Antimicrobial Peptide Reference
Glycopeptide antibiotic from Actinoplanes teichomyceticus with long half-life, used for gram-positive infections including MRSA.
Teixobactin Analog: Oligopeptide Research Reference
Teixobactin Analog, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Telavancin: Antimicrobial Peptide Reference
Lipoglycopeptide antibiotic with dual mechanism inhibiting cell wall synthesis and disrupting membrane potential in gram-positive bacteria.
Telavancin: Oligopeptide Research Reference
telavancin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Telomerase Peptide: Oligopeptide Research Reference
telomerase peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Temporin 1a: Antimicrobial Peptide Reference
temporin-1a is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Temporin 1b: Antimicrobial Peptide Reference
temporin-1b is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biolo...
Temporin 1ce: Structure, Function, and Significance
Temporin-1Ce is one of the most potent temporins, showing activity against drug-resistant bacteria including MRSA. Covers molecular mechanisms, biological ac...
Temporin 1OG: Antimicrobial Peptide Reference
temporin-1OG is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...
Temporin 1OMa: Antimicrobial Peptide Reference
temporin-1OMa is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its bio...
Temporin 1Ta: Antimicrobial Peptide Reference
temporin-1Ta is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...
Temporin 1Td: Antimicrobial Peptide Reference
temporin-1Td is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...
Temporin 1Tl: Antimicrobial Peptide Reference
temporin-1Tl is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This peptide or oligopeptide is studied for its biol...
Temporin A: Antimicrobial Peptide Reference
Shortest known natural antimicrobial peptide from frog skin with potent activity against gram-positive bacteria. Covers molecular mechanisms, biological acti...
Temporin A: Antimicrobial Peptide Reference
Tridecapeptide from red frog skin with potent gram-positive bactericidal activity. This antimicrobial peptide demonstrates activity against pathogens and is ...
Temporin B: Antimicrobial Peptide Reference
Tridecapeptide from temporin family with antimicrobial activity in frog skin secretions. This antimicrobial peptide demonstrates activity against pathogens a...
Temporin L: Antimicrobial Peptide Reference
Potent frog AMP with activity against MRSA and efficacy in infection models. This antimicrobial peptide demonstrates activity against pathogens and is studie...
Temporin: Structure, Function, and Significance
Temporins are short (10-14 aa) antimicrobial peptides from frog skin. They are among the smallest known AMPs with potent antibacterial activity.
Tepotinib: Oligopeptide Research Reference
Tepotinib, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Teriparatide Biosimilar: Oligopeptide Research Reference
Biosimilar recombinant PTH(1-34) for osteoporosis with equivalent bone formation effects. This peptide or oligopeptide is studied for its biological activity...
Teriparatide: Oligopeptide Research Reference
teriparatide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Teriparatide: Oligopeptide Research Reference
Recombinant PTH(1-34) for osteoporosis stimulating osteoblast-mediated bone formation via PTH1R. This peptide or oligopeptide is studied for its biological a...
Teriparatide: Oligopeptide Research Reference
Recombinant PTH(1-34) that stimulates osteoblast activity for osteoporosis treatment, the first anabolic bone agent. Covers molecular mechanisms, biological ...
Terlipressin: Oligopeptide Research Reference
Glypressin analog for hepatorenal syndrome providing selective splanchnic vasoconstriction. This peptide or oligopeptide is studied for its biological activi...
Tesamorelin: Oligopeptide Research Reference
Synthetic GHRH analog for HIV-associated lipodystrophy reducing visceral adipose tissue. This peptide or oligopeptide is studied for its biological activity,...
Testosterone Hormone: Endogenous Peptide Hormone Reference
Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Testosterone Peptide Hormone: Comprehensive Peptide Refer...
Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Testosterone Protein Hormone: Comprehensive Peptide Refer...
Testosterone, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinic...
Tetanus Toxin (TeNT): Peptide Toxin in Pharmacology Refer...
Tetanus Toxin (TeNT), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tetrabody System 1: Oligopeptide Research Reference
A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Tetrabody System 2: Oligopeptide Research Reference
A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Tetrabody System 3: Oligopeptide Research Reference
A tetrabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges ...
Tetrabody: Oligopeptide Research Reference
Comprehensive reference for tetrabody, covering molecular structure, pharmacological properties, receptor interactions,
Tetradecyl Aminobutyroylvalylaminobutyric Urea Trifluoroa...
Comprehensive reference for Tetradecyl Aminobutyroylvalylaminobutyric Urea Trifluoroa..., a peptide compound with applications in research and therapeutics.
Tetrahymena thermiphila: Oligopeptide Research Reference
Mucocyst discharge, antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Tetrahymena thermophila: Oligopeptide Research Reference
Binds surface receptor during mating. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Tetrazine Purification: Analytical Technique in Peptide R...
A purification technique for separating and isolating peptides using Tetrazine. This analytical technique provides valuable insights into peptide structure, ...
Tetrodotoxin (TTX): Peptide Toxin in Pharmacology Reference
Tetrodotoxin (TTX), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tetrodotoxin Analogs: Oligopeptide Research Reference
Tetrodotoxin Analogs, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
TEV Cleavage Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using TEV Cleavage. This analytical technique provides valuable insights into peptide structur...
Textilotoxin: Peptide Toxin in Pharmacology Reference
Textilotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
TGF Beta 1 Hormone: Endogenous Peptide Hormone Reference
TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 1 Peptide Hormone: Comprehensive Peptide Reference
TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 1 Protein Hormone: Comprehensive Peptide Reference
TGF Beta 1, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 1: Endogenous Peptide Hormone Reference
TGF-beta-1 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
TGF Beta 2 Hormone: Endogenous Peptide Hormone Reference
TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 2 Peptide Hormone: Comprehensive Peptide Reference
TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 2 Protein Hormone: Comprehensive Peptide Reference
TGF Beta 2, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 2: Endogenous Peptide Hormone Reference
TGF-beta-2 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
TGF Beta 3 Hormone: Endogenous Peptide Hormone Reference
TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 3 Peptide Hormone: Comprehensive Peptide Reference
TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 3 Protein Hormone: Comprehensive Peptide Reference
TGF Beta 3, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
TGF Beta 3: Endogenous Peptide Hormone Reference
TGF-beta-3 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
TGF Beta 5: Endogenous Peptide Hormone Reference
TGF-beta-5 is a growth factor or regulatory peptide involved in cell proliferation, differentiation, and tissue homeostasis.
TGF Beta Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting TGF Beta Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struc...
TGF-beta Pathway Peptide 1: Comprehensive Peptide Reference
A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
TGF-beta Pathway Peptide 2: Comprehensive Peptide Reference
A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
TGF-beta Pathway Peptide 3: Comprehensive Peptide Reference
A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
TGF-beta Pathway Peptide 4: Comprehensive Peptide Reference
A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
TGF-beta Pathway Peptide 5: Comprehensive Peptide Reference
A peptide involved in the TGF-beta signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Thaumatin: Oligopeptide Research Reference
thaumatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicati...
The Incretin Effect: Peptide Family Reference
Physiological phenomenon where oral glucose produces greater insulin secretion than intravenous glucose, mediated by GLP-1 and GIP.
Therapeutic Target Database (TTD)
Comprehensive reference for Therapeutic Target Database (TTD), a peptide compound with applications in research and therapeutics.
Therapeutic: Oligopeptide Research Reference
Therapeutic is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its biological activi...
Thermal Cleavable Purification
A purification technique for separating and isolating peptides using Thermal Cleavable. This analytical technique provides valuable insights into peptide str...
Thermo Q Exactive: Oligopeptide Research Reference
Orbitrap mass spectrometer for high-resolution peptide analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity rela...
Thermo Vanquish: Oligopeptide Research Reference
UHPLC system for high-speed peptide separation and analysis. This peptide or oligopeptide is studied for its biological activity, structure-activity relation...
Thermodynamic Integration for Peptides
A computational method for studying peptides using Thermodynamic Integration. This analytical technique provides valuable insights into peptide structure, pu...
thermodynamics Resource: Oligopeptide Research Reference
The thermodynamics database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biologica...
Thermosensitive Hydrogel: Oligopeptide Research Reference
Temperature-responsive hydrogels forming depot at body temperature for sustained release. This peptide or oligopeptide is studied for its biological activity...
Thick Film Synthesis: Analytical Technique in Peptide Res...
A peptide synthesis method using Thick Film for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...
Thin Film Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Thin Film for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Thioester Bonds in Peptides: Comprehensive Peptide Reference
Explore thioester bonds in peptide biosynthesis, including intein-mediated ligation. This modification affects peptide stability, receptor binding, and biolo...
Thiol Ene Synthesis: Analytical Technique in Peptide Rese...
A peptide synthesis method using Thiol Ene for producing peptides with specific properties. This analytical technique provides valuable insights into peptide...
Thionin: Oligopeptide Research Reference
Thionin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Thioredoxin 1: Oligopeptide Research Reference
thioredoxin 1 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Thr6-bradykinin: Antimicrobial Peptide Reference
Thr6-bradykinin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Threonine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Threonine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological act...
Threonine Modification: Post-Translational Modification R...
Post-translational modifications of Threonine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologica...
Threonine Peptide: Oligopeptide Research Reference
Threonine (T) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological acti...
Thrombin Cleavage Purification
A purification technique for separating and isolating peptides using Thrombin Cleavage. This analytical technique provides valuable insights into peptide str...
Thrombin Inhibitor: Enzyme in Peptide Biology Reference
thrombin inhibitor in peptide research. This enzyme plays important roles in peptide metabolism and is studied for its biochemical mechanisms, substrate spec...
Thrombopoietin Hormone: Endogenous Peptide Hormone Reference
Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Thrombopoietin Peptide Hormone
Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Thrombopoietin Protein Hormone
Thrombopoietin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clin...
Thrombopoietin: Endogenous Peptide Hormone Reference
Glycoprotein hormone that stimulates megakaryocyte proliferation and platelet production through the c-Mpl receptor. Covers molecular mechanisms, biological ...
Thymopentin: Antimicrobial Peptide Reference
Synthetic pentapeptide from thymopoietin with T-cell stimulating activity. This antimicrobial peptide demonstrates activity against pathogens and is studied ...
Thymosin Alpha-1: Antimicrobial Peptide Reference
Thymic peptide with immunomodulatory properties enhancing T-cell maturation. This antimicrobial peptide demonstrates activity against pathogens and is studie...
Thymosin alpha1: Structure, Function, and Significance
Thymosin alpha1 is a 28-amino acid peptide from thymus tissue that modulates immune function and is used as an immunotherapy agent.
Thyroid Cancer: Oligopeptide Research Reference
Malignant transformation of thyroid epithelium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and po...
Thyrotropin-Releasing Hormone: Comprehensive Peptide Refe...
Tripeptide hypothalamic hormone stimulating TSH and prolactin release. This neuropeptide is involved in neurological signaling and is studied for its roles i...
Thyrotropin-Releasing Hormone: Comprehensive Peptide Refe...
A tripeptide (pGlu-His-Pro-NH₂) from the hypothalamus that initiates the thyroid axis by stimulating TSH and prolactin release from the anterior pituitary.
Ticin: Structure, Function, and Significance
Ticin is a short antimicrobial peptide from horseshoe crab with disulfide-stabilized structure. This antimicrobial peptide demonstrates activity against path...
TIGIT Blocker: Oligopeptide Research Reference
TIGIT blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Tildrakizumab: Oligopeptide Research Reference
tildrakizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
TIM 3 Blocker: Oligopeptide Research Reference
TIM 3 blocker in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
time-to-progression Resource: Comprehensive Peptide Refer...
The time-to-progression database or resource for peptide research, providing data on structure, function, and interactions.
time-to-response Resource: Comprehensive Peptide Reference
The time-to-response database or resource for peptide research, providing data on structure, function, and interactions.
Tirzepatide - First-in-Human (NCT03142936)
First-in-human trial of tirzepatide for type 2 diabetes. This peptide or oligopeptide is studied for its biological activity, structure-activity relationship...
Tirzepatide - SURMOUNT-1 (NCT04184622)
SURMOUNT-1 trial of tirzepatide for obesity. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
Tirzepatide development, glucagon receptor biology
Tirzepatide development, glucagon receptor biology is a bioactive compound with applications in peptide research and therapeutics.
Tirzepatide Mounjaro and Zepbound
Dual GIP/GLP-1 receptor agonist approved for both type 2 diabetes (Mounjaro) and obesity (Zepbound) with superior metabolic effects.
Tirzepatide: Oligopeptide Research Reference
Dual GIP/GLP-1 receptor agonist with C-20 fatty diacid for once-weekly dosing. This peptide or oligopeptide is studied for its biological activity, structure...
Tisotumab Vedotin: Oligopeptide Research Reference
Tisotumab Vedotin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tityustoxin Kv1.3: Peptide Toxin in Pharmacology Reference
Scorpion toxin selectively blocking Kv1.3 potassium channel for immunomodulation. This peptide toxin is derived from venom and studied for its pharmacologica...
TLR Agonist Conjugates: Oligopeptide Research Reference
TLR Agonist Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
TM-align Resource: Oligopeptide Research Reference
The TM-align database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
TM-score Resource: Oligopeptide Research Reference
The TM-score database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
TNF Alpha Hormone: Endogenous Peptide Hormone Reference
TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
TNF Alpha Peptide Hormone: Comprehensive Peptide Reference
TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
TNF Alpha Protein Hormone: Comprehensive Peptide Reference
TNF Alpha, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical ...
TNF Beta Hormone: Endogenous Peptide Hormone Reference
TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
TNF Beta Peptide Hormone: Endogenous Peptide Hormone Refe...
TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
TNF Beta Protein Hormone: Endogenous Peptide Hormone Refe...
TNF Beta, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
TNF Binding Protein: Oligopeptide Research Reference
TNF binding protein in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
TNF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting TNF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
TNF-alpha (Tumor Necrosis Factor Alpha)
Comprehensive reference for TNF-alpha (Tumor Necrosis Factor Alpha), a peptide compound with applications in research and therapeutics.
Tocilizumab: Oligopeptide Research Reference
tocilizumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
ToF SIMS Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using ToF SIMS. This analytical technique provides valuable insights into peptide structure, purity, and ...
Tokenization for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Tokenization. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Toll Like Receptor Agonist TLR1-agonist-1
Comprehensive reference for toll like receptor agonist TLR1-agonist-1, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR10-agonist-10
Comprehensive reference for toll like receptor agonist TLR10-agonist-10, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR11-agonist-11
Comprehensive reference for toll like receptor agonist TLR11-agonist-11, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR12-agonist-12
Comprehensive reference for toll like receptor agonist TLR12-agonist-12, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR13-agonist-13
Comprehensive reference for toll like receptor agonist TLR13-agonist-13, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR14-agonist-14
Comprehensive reference for toll like receptor agonist TLR14-agonist-14, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR15-agonist-15
Comprehensive reference for toll like receptor agonist TLR15-agonist-15, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR16-agonist-16
Comprehensive reference for toll like receptor agonist TLR16-agonist-16, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR17-agonist-17
Comprehensive reference for toll like receptor agonist TLR17-agonist-17, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR18-agonist-18
Comprehensive reference for toll like receptor agonist TLR18-agonist-18, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR19-agonist-19
Comprehensive reference for toll like receptor agonist TLR19-agonist-19, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR2-agonist-2
Comprehensive reference for toll like receptor agonist TLR2-agonist-2, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR20-agonist-20
Comprehensive reference for toll like receptor agonist TLR20-agonist-20, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR21-agonist-21
Comprehensive reference for toll like receptor agonist TLR21-agonist-21, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR22-agonist-22
Comprehensive reference for toll like receptor agonist TLR22-agonist-22, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR23-agonist-23
Comprehensive reference for toll like receptor agonist TLR23-agonist-23, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR24-agonist-24
Comprehensive reference for toll like receptor agonist TLR24-agonist-24, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR25-agonist-25
Comprehensive reference for toll like receptor agonist TLR25-agonist-25, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR26-agonist-26
Comprehensive reference for toll like receptor agonist TLR26-agonist-26, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR27-agonist-27
Comprehensive reference for toll like receptor agonist TLR27-agonist-27, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR28-agonist-28
Comprehensive reference for toll like receptor agonist TLR28-agonist-28, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR29-agonist-29
Comprehensive reference for toll like receptor agonist TLR29-agonist-29, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR3-agonist-3
Comprehensive reference for toll like receptor agonist TLR3-agonist-3, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR30-agonist-30
Comprehensive reference for toll like receptor agonist TLR30-agonist-30, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR31-agonist-31
Comprehensive reference for toll like receptor agonist TLR31-agonist-31, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR32-agonist-32
Comprehensive reference for toll like receptor agonist TLR32-agonist-32, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR33-agonist-33
Comprehensive reference for toll like receptor agonist TLR33-agonist-33, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR34-agonist-34
Comprehensive reference for toll like receptor agonist TLR34-agonist-34, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR35-agonist-35
Comprehensive reference for toll like receptor agonist TLR35-agonist-35, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR36-agonist-36
Comprehensive reference for toll like receptor agonist TLR36-agonist-36, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR37-agonist-37
Comprehensive reference for toll like receptor agonist TLR37-agonist-37, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR38-agonist-38
Comprehensive reference for toll like receptor agonist TLR38-agonist-38, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR39-agonist-39
Comprehensive reference for toll like receptor agonist TLR39-agonist-39, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR4-agonist-4
Comprehensive reference for toll like receptor agonist TLR4-agonist-4, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR40-agonist-40
Comprehensive reference for toll like receptor agonist TLR40-agonist-40, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR41-agonist-41
Comprehensive reference for toll like receptor agonist TLR41-agonist-41, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR42-agonist-42
Comprehensive reference for toll like receptor agonist TLR42-agonist-42, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR43-agonist-43
Comprehensive reference for toll like receptor agonist TLR43-agonist-43, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR44-agonist-44
Comprehensive reference for toll like receptor agonist TLR44-agonist-44, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR45-agonist-45
Comprehensive reference for toll like receptor agonist TLR45-agonist-45, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR46-agonist-46
Comprehensive reference for toll like receptor agonist TLR46-agonist-46, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR47-agonist-47
Comprehensive reference for toll like receptor agonist TLR47-agonist-47, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR48-agonist-48
Comprehensive reference for toll like receptor agonist TLR48-agonist-48, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR49-agonist-49
Comprehensive reference for toll like receptor agonist TLR49-agonist-49, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR5-agonist-5
Comprehensive reference for toll like receptor agonist TLR5-agonist-5, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR50-agonist-50
Comprehensive reference for toll like receptor agonist TLR50-agonist-50, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR6-agonist-6
Comprehensive reference for toll like receptor agonist TLR6-agonist-6, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR7-agonist-7
Comprehensive reference for toll like receptor agonist TLR7-agonist-7, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR8-agonist-8
Comprehensive reference for toll like receptor agonist TLR8-agonist-8, covering molecular structure, pharmacological properties, receptor interactions,
Toll Like Receptor Agonist TLR9-agonist-9
Comprehensive reference for toll like receptor agonist TLR9-agonist-9, covering molecular structure, pharmacological properties, receptor interactions,
Tomato Peptide: Oligopeptide Research Reference
A bioactive peptide derived from tomato with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Tomato Tomatine: Oligopeptide Research Reference
tomato tomatine in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
tomography for Peptides: Analytical Technique in Peptide ...
Application of tomography technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its bi...
Topoisomerase Inhibitor PDC: Comprehensive Peptide Reference
A peptide-drug conjugate targeting Topoisomerase Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, ...
Topoisomerase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Topoisomerase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Total tau (t-tau): Oligopeptide Research Reference
Total tau (t-tau), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Toxcin 1: Peptide Toxin in Pharmacology Reference
toxcin-1 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...
Toxcin 2: Peptide Toxin in Pharmacology Reference
toxcin-2 is a snake venom peptide toxin with specific pharmacological activity. This peptide toxin is derived from venom and studied for its pharmacological ...
toxicity Resource: Oligopeptide Research Reference
The toxicity database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological acti...
Toxicity: Oligopeptide Research Reference
Organ damage (liver, kidney, heart, nerve, blood). This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and...
Toxoplasma SAG1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Toxoplasma SAG1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure...
Toxoplasma SAG1: Oligopeptide Research Reference
Toxoplasma-SAG1 is a peptide antigen used in vaccine development for infectious disease prevention. This peptide or oligopeptide is studied for its biologica...
TP53 Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting TP53 Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
TPO Hormone: Endogenous Peptide Hormone Reference
TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TPO Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting TPO Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
TPO Peptide Hormone: Endogenous Peptide Hormone Reference
TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TPO Protein Hormone: Endogenous Peptide Hormone Reference
TPO, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TR FRET Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using TR FRET. This analytical technique provides valuable insights into peptide structure, purity, and c...
Trabectedin Marine Alkaloid: Comprehensive Peptide Reference
Tetrahydroisoquinoline alkaloid from marine tunicate Ecteinascidia turbinata for soft tissue sarcoma and ovarian cancer.
Trabectedin: Oligopeptide Research Reference
Marine-derived tetrahydroisoquinoline alkaloid that binds DNA minor groove, used for soft tissue sarcoma and ovarian cancer.
Trachynilin: Oligopeptide Research Reference
Trachynilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tramadol Weak Opioid: Neuropeptide in Neuroscience Reference
Weak opioid agonist prodrug with serotonin-norepinephrine reuptake inhibition. This neuropeptide is involved in neurological signaling and is studied for its...
Trans Cyclooctene Purification
A purification technique for separating and isolating peptides using Trans Cyclooctene. This analytical technique provides valuable insights into peptide str...
TransCon PTH: Oligopeptide Research Reference
Long-acting prodrug of PTH(1-34) using TransCon technology for continuous release. This peptide or oligopeptide is studied for its biological activity, struc...
Transcription factor: Oligopeptide Research Reference
Comprehensive reference for transcription factor, covering molecular structure, pharmacological properties, receptor interactions,
Transdermal delivery: Oligopeptide Research Reference
Comprehensive reference for transdermal delivery, covering molecular structure, pharmacological properties, receptor interactions,
Transdermal Patch Peptide: Comprehensive Peptide Reference
Transdermal delivery systems for peptide drugs through intact skin. This peptide or oligopeptide is studied for its biological activity, structure-activity r...
Transdermal Peptide Delivery: Comprehensive Peptide Refer...
Learn transdermal approaches for non-invasive peptide delivery across the skin barrier using chemical enhancers. Covers molecular mechanisms, biological acti...
Transdermal System 1: Oligopeptide Research Reference
A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Transdermal System 2: Oligopeptide Research Reference
A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Transdermal System 3: Oligopeptide Research Reference
A transdermal-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenge...
Transferase PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Transferase for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Transformer for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using Transformer. This analytical technique provides valuable insights into peptide structure, purity, and char...
Transforming Growth Factor beta1-1-391
Comprehensive reference for transforming growth factor beta1-1-391, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta1-active-1-112
Comprehensive reference for transforming growth factor beta1-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta1-latent-1-391
Comprehensive reference for transforming growth factor beta1-latent-1-391, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta2-1-112
Comprehensive reference for transforming growth factor beta2-1-112, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta2-active-1-112
Comprehensive reference for transforming growth factor beta2-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta3-1-112
Comprehensive reference for transforming growth factor beta3-1-112, covering molecular structure, pharmacological properties, receptor interactions,
Transforming Growth Factor beta3-active-1-112
Comprehensive reference for transforming growth factor beta3-active-1-112, covering molecular structure, pharmacological properties, receptor interactions,
Transition Path for Peptides: Comprehensive Peptide Refer...
A computational method for studying peptides using Transition Path. This analytical technique provides valuable insights into peptide structure, purity, and ...
Trastuzumab Deruxtecan: Oligopeptide Research Reference
Trastuzumab Deruxtecan, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Tremelimumab: Oligopeptide Research Reference
tremelimumab in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
TRH (Thyrotropin-releasing hormone)
Comprehensive reference for TRH (Thyrotropin-releasing hormone), a peptide compound with applications in research and therapeutics.
TRH 1-3: Peptide Fragment Reference
Comprehensive reference for TRH 1-3 variant, covering molecular structure, pharmacological properties, receptor interactions,
TRH Hormone: Endogenous Peptide Hormone Reference
TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TRH Peptide Hormone: Endogenous Peptide Hormone Reference
TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TRH Protein Hormone: Endogenous Peptide Hormone Reference
TRH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TRH: Antimicrobial Peptide Reference
TRH, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Triabody System 1: Oligopeptide Research Reference
A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Triabody System 2: Oligopeptide Research Reference
A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Triabody System 3: Oligopeptide Research Reference
A triabody-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challenges i...
Triabody: Oligopeptide Research Reference
Comprehensive reference for triabody, covering molecular structure, pharmacological properties, receptor interactions,
Triazole Stapling (Click Chemistry)
Introduction of triazole cross-links using click chemistry. Stabilizes peptides. This peptide or oligopeptide is studied for its biological activity, structu...
Trichocyst discharged as defensive filament
Ciliate peptides. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
Tripeptide-9 Citrulline + Tripeptide-10 Citrulline
Comprehensive reference for Tripeptide-9 Citrulline + Tripeptide-10 Citrulline, a peptide compound with applications in research and therapeutics.
Triptolide: Structure, Function, and Significance
Triptolide is a bioactive diterpenoid from thunder god vine with potent immunosuppressive and anti-inflammatory properties.
Triptorelin Pamoate: Oligopeptide Research Reference
Triptorelin Pamoate, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Triptorelin Sustained Release: Comprehensive Peptide Refe...
Long-acting triptorelin depot formulations for sustained GnRH receptor suppression in prostate cancer and central precocious puberty.
Triptorelin: Oligopeptide Research Reference
triptorelin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
Triptorelin: Oligopeptide Research Reference
Long-acting GnRH agonist with D-Trp substitution for profound gonadotropin suppression. This peptide or oligopeptide is studied for its biological activity, ...
Tritrpticin: Antimicrobial Peptide Reference
Trp-rich AMP from bullfrog skin with broad-spectrum activity and low hemolysis. This antimicrobial peptide demonstrates activity against pathogens and is stu...
Triturin: Antimicrobial Peptide Reference
triturin is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...
TrkB Agonist: Oligopeptide Research Reference
TrkB agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
TrkC Agonist: Oligopeptide Research Reference
TrkC agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Troponin I: Oligopeptide Research Reference
Cardiac muscle protein. MI biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Troponin T: Oligopeptide Research Reference
Cardiac muscle protein. MI biomarker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Trout NPY: Oligopeptide Research Reference
Trout NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
TrRosetta for Peptides: Analytical Technique in Peptide R...
A computational method for studying peptides using TrRosetta. This analytical technique provides valuable insights into peptide structure, purity, and charac...
Trypanosoma brucei: Oligopeptide Research Reference
Variable surface glycoprotein epitope switching. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Trypanosoma cruzi: Oligopeptide Research Reference
Transfers sialic acid to parasite surface. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Trypsin Inhibitor (Kunitz): Comprehensive Peptide Reference
Comprehensive reference for Trypsin Inhibitor (Kunitz), a peptide compound with applications in research and therapeutics.
Tryptophan Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Tryptophan including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological ac...
Tryptophan Modification: Post-Translational Modification ...
Post-translational modifications of Tryptophan including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biologic...
Tryptophan Peptide: Oligopeptide Research Reference
Tryptophan (W) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological act...
Ts1 (Tityustoxin): Peptide Toxin in Pharmacology Reference
Ts1 (Tityustoxin), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
TSH Family Peptides: Endogenous Peptide Hormone Reference
Guide to thyroid-stimulating hormone family peptides and their regulation of thyroid function. This endogenous peptide hormone plays important roles in physi...
TSH Hormone: Endogenous Peptide Hormone Reference
TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TSH Peptide Hormone: Endogenous Peptide Hormone Reference
TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
TSH Protein Hormone: Endogenous Peptide Hormone Reference
TSH, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
Tube Assembly System 1: Oligopeptide Research Reference
A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Tube Assembly System 2: Oligopeptide Research Reference
A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Tube Assembly System 3: Oligopeptide Research Reference
A tube-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Tuberculosis Peptides: Oligopeptide Research Reference
Peptides associated with Tuberculosis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biol...
Tuberculosis: Oligopeptide Research Reference
M. tuberculosis. Treatments: RIPE therapy (4 drugs, 6 months). This peptide or oligopeptide is studied for its biological activity, structure-activity relati...
Tubulin Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Tubulin Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, struct...
Tubulin PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting Tubulin for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Tubulin polymer: Oligopeptide Research Reference
Comprehensive reference for tubulin polymer, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Marker AFP: Oligopeptide Research Reference
tumor marker AFP in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Tumor Marker CA125: Oligopeptide Research Reference
tumor marker CA125 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Tumor Marker CA19 9: Oligopeptide Research Reference
tumor marker CA19 9 in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Tumor Marker CEA: Oligopeptide Research Reference
tumor marker CEA in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Tumor Marker HCG: Oligopeptide Research Reference
tumor marker HCG in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Tumor Marker PSA: Oligopeptide Research Reference
tumor marker PSA in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Tumor Necrosis Factor LT-alpha-1-171
Comprehensive reference for tumor necrosis factor LT-alpha-1-171, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor LT-beta-1-171
Comprehensive reference for tumor necrosis factor LT-beta-1-171, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-alpha-1-100
Comprehensive reference for tumor necrosis factor TNF-alpha-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-alpha-1-150
Comprehensive reference for tumor necrosis factor TNF-alpha-1-150, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-alpha-1-233
Comprehensive reference for tumor necrosis factor TNF-alpha-1-233, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-alpha-1-50
Comprehensive reference for tumor necrosis factor TNF-alpha-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-beta-1-100
Comprehensive reference for tumor necrosis factor TNF-beta-1-100, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-beta-1-171
Comprehensive reference for tumor necrosis factor TNF-beta-1-171, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TNF-beta-1-50
Comprehensive reference for tumor necrosis factor TNF-beta-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TRAIL-1-114
Comprehensive reference for tumor necrosis factor TRAIL-1-114, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TRAIL-1-180
Comprehensive reference for tumor necrosis factor TRAIL-1-180, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TRAIL-1-281
Comprehensive reference for tumor necrosis factor TRAIL-1-281, covering molecular structure, pharmacological properties, receptor interactions,
Tumor Necrosis Factor TRAIL-1-50
Comprehensive reference for tumor necrosis factor TRAIL-1-50, covering molecular structure, pharmacological properties, receptor interactions,
Turkey Beta-Defensin (TvBD): Comprehensive Peptide Reference
Comprehensive reference for Turkey Beta-Defensin (TvBD), a peptide compound with applications in research and therapeutics.
Turkey Cathelicidin: Oligopeptide Research Reference
Turkey Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Turkey Defensin: Oligopeptide Research Reference
Turkey Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Turmeric Peptide: Oligopeptide Research Reference
A bioactive peptide derived from turmeric with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-acti...
Turn Assembly System 1: Oligopeptide Research Reference
A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Turn Assembly System 2: Oligopeptide Research Reference
A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Turn Assembly System 3: Oligopeptide Research Reference
A turn-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key challen...
Turtle Cathelicidin: Oligopeptide Research Reference
Turtle Cathelicidin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Turtle Defensin: Oligopeptide Research Reference
Turtle Defensin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Turtle Peptides: Oligopeptide Research Reference
Antimicrobial, Biomineralization. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Turtle Serum Peptides: Oligopeptide Research Reference
Turtle Serum Peptides, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Turtle Shell Matrix Peptides: Comprehensive Peptide Refer...
Comprehensive reference for Turtle Shell Matrix Peptides, a peptide compound with applications in research and therapeutics.
Tx3a: Peptide Toxin in Pharmacology Reference
Tx3a is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...
Tx3b: Peptide Toxin in Pharmacology Reference
Tx3b is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...
Tx3c: Peptide Toxin in Pharmacology Reference
Tx3c is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharma...
Tx4(4 7): Peptide Toxin in Pharmacology Reference
Tx4(4-7) is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its ph...
Type 1 Diabetes Mellitus: Oligopeptide Research Reference
Comprehensive reference for Type 1 Diabetes Mellitus, a peptide compound with applications in research and therapeutics.
Type 1 Diabetes: Oligopeptide Research Reference
Autoimmune β-cell destruction → absolute insulin deficiency. HLA-DR3/DR4 associated. Treatments: insulin replacement (basal-bolus), CGM, insulin pumps.
Type 2 Diabetes: Oligopeptide Research Reference
Chronic metabolic disorder: insulin resistance + β-cell failure. Risk factors: obesity, inactivity, genetics. Complications: retinopathy, nephropathy, neurop...
Type1 Diabetes Peptides: Oligopeptide Research Reference
Peptides associated with Type1 Diabetes including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its bi...
Tyrocidine A1: Antimicrobial Peptide Reference
tyrocidine-A1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Tyrocidine A2: Antimicrobial Peptide Reference
tyrocidine-A2 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Tyrocidine A3: Antimicrobial Peptide Reference
tyrocidine-A3 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Tyrocidine B1: Antimicrobial Peptide Reference
tyrocidine-B1 is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Tyrocidine: Antimicrobial Peptide Reference
tyrocidine is a peptide antibiotic produced by bacteria with antimicrobial activity used in clinical and agricultural applications.
Tyrosine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Tyrosine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological acti...
Tyrosine Modification: Post-Translational Modification Re...
Post-translational modifications of Tyrosine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological...
Tyrosine Peptide: Oligopeptide Research Reference
Tyrosine (Y) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. Covers molecular mechanisms, biological activ...
Tyrothricin: Antimicrobial Peptide Reference
Mixture of gramicidins and tyrocidines from Bacillus brevis used as a topical antimicrobial for throat and skin infections.
U Urealyticum Peptide: Oligopeptide Research Reference
A peptide associated with U Urealyticum for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, struct...
U-50488: Neuropeptide in Neuroscience Reference
Potent selective kappa-opioid agonist with antinociceptive and diuretic effects. This neuropeptide is involved in neurological signaling and is studied for i...
U-69593: Neuropeptide in Neuroscience Reference
Selective kappa-opioid receptor agonist for pharmacological studies. This neuropeptide is involved in neurological signaling and is studied for its roles in ...
Ubiquitin → Proteasome (Degradation Signal)
Comprehensive reference for Ubiquitin → Proteasome (Degradation Signal), a peptide compound with applications in research and therapeutics.
Ubiquitin-proteasome system, 2004 Nobel Prize (Ciechanove...
Ubiquitin-proteasome system, 2004 Nobel Prize (Ciechanove... is a bioactive compound with applications in peptide research and therapeutics.
Ubiquitination (Lys): Post-Translational Modification Ref...
Ubiquitination (Lys), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Ubrogepant: Oligopeptide Research Reference
Oral CGRP receptor antagonist for acute migraine treatment providing pain freedom. This peptide or oligopeptide is studied for its biological activity, struc...
Uc Peptides: Oligopeptide Research Reference
Peptides associated with Uc including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological act...
UCSC Genome Browser: Oligopeptide Research Reference
Genome browser for visualizing genomic data. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and poten...
UHPLC Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using UHPLC. This analytical technique provides valuable insights into peptide structure, purity, and cha...
Ulefipant: Oligopeptide Research Reference
NK1 receptor antagonist peptide under investigation for chemotherapy-induced nausea and vomiting. This peptide or oligopeptide is studied for its biological ...
Ultra-Rapid Insulin Lispro: Comprehensive Peptide Reference
Ultra-rapid insulin lispro formulation with treprostinil and citrate for accelerated initial absorption. This peptide or oligopeptide is studied for its biol...
Ultrafiltration Purification: Comprehensive Peptide Refer...
A purification technique for separating and isolating peptides using Ultrafiltration. This analytical technique provides valuable insights into peptide struc...
Ultrasonic Synthesis: Analytical Technique in Peptide Res...
A peptide synthesis method using Ultrasonic for producing peptides with specific properties. This analytical technique provides valuable insights into peptid...
UMAP for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using UMAP. This analytical technique provides valuable insights into peptide structure, purity, and characteriz...
Umbrella Sampling for Peptides
A computational method for studying peptides using Umbrella Sampling. This analytical technique provides valuable insights into peptide structure, purity, an...
UniProt Resource: Oligopeptide Research Reference
The UniProt database or resource for peptide research, providing data on structure, function, and interactions. Covers molecular mechanisms, biological activ...
UniProt: Oligopeptide Research Reference
Comprehensive resource for protein sequence and functional information. This peptide or oligopeptide is studied for its biological activity, structure-activi...
United Atom for Peptides: Analytical Technique in Peptide...
A computational method for studying peptides using United Atom. This analytical technique provides valuable insights into peptide structure, purity, and char...
UPLC Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using UPLC. This analytical technique provides valuable insights into peptide structure, purity, and char...
Urinary Tract Infection: Oligopeptide Research Reference
Urinary Tract Infection, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Urocortin: Neuropeptide in Neuroscience Reference
A 40-amino acid neuropeptide related to CRH that preferentially activates CRH-R2 receptors, mediating stress response, feeding, and cardiovascular function.
Urodilatin Hormone: Endogenous Peptide Hormone Reference
Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Urodilatin Peptide Hormone: Comprehensive Peptide Reference
Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Urodilatin Protein Hormone: Comprehensive Peptide Reference
Urodilatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical...
Urodilatin: Endogenous Peptide Hormone Reference
Urodilatin is a natriuretic peptide that regulates blood pressure and fluid balance through vasodilation and natriuresis.
Urodilatin: Oligopeptide Research Reference
urodilatin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Urotensin II: Oligopeptide Research Reference
Cyclic 11-amino acid peptide that activates the UT receptor, considered the most potent mammalian vasoconstrictor. Covers molecular mechanisms, biological ac...
UV Cleavable Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using UV Cleavable. This analytical technique provides valuable insights into peptide structur...
UV-Vis Spectroscopy for Peptides
Understand UV-Vis spectroscopy for peptide quantification, purity assessment, and conformational studies. This peptide or oligopeptide is studied for its bio...
UV1: Oligopeptide Research Reference
UV1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
V Cholerae Peptide: Oligopeptide Research Reference
A peptide associated with V Cholerae for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure...
V5 Tag Purification: Analytical Technique in Peptide Rese...
A purification technique for separating and isolating peptides using V5 Tag. This analytical technique provides valuable insights into peptide structure, pur...
Vaborbactam: Oligopeptide Research Reference
Boronic acid-based beta-lactamase inhibitor that targets KPC carbapenemases, restoring meropenem activity against resistant Enterobacterales.
Vaccine Conjugates: Oligopeptide Research Reference
Vaccine Conjugates, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Vaginal Peptide Delivery: Oligopeptide Research Reference
Vaginal delivery systems for local and systemic peptide drug administration. This peptide or oligopeptide is studied for its biological activity, structure-a...
Valine Metabolism: Oligopeptide Research Reference
Metabolic pathways involving Valine including biosynthesis, catabolism, and transamination. This peptide or oligopeptide is studied for its biological activi...
Valine Modification: Post-Translational Modification Refe...
Post-translational modifications of Valine including phosphorylation, methylation, acetylation, and ubiquitination. Covers molecular mechanisms, biological a...
Valine Peptide: Oligopeptide Research Reference
Valine (V) is one of the 20 standard amino acids. It plays essential roles in protein structure and function. This peptide or oligopeptide is studied for its...
Vancomycin - MRSA (NCT00000127)
Trial of vancomycin for MRSA infections. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential...
Vancomycin: Antimicrobial Peptide Reference
Vancomycin is a glycopeptide antibiotic from Amycolatopsis orientalis that inhibits cell wall synthesis in gram-positive bacteria, including MRSA.
Vapreotide: Oligopeptide Research Reference
Vapreotide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Variational Autoencoder for Peptides
A computational method for studying peptides using Variational Autoencoder. This analytical technique provides valuable insights into peptide structure, puri...
Vascular Endothelial Growth Factor 121
Comprehensive reference for vascular endothelial growth factor 121, covering molecular structure, pharmacological properties, receptor interactions,
Vascular Endothelial Growth Factor 145
Comprehensive reference for vascular endothelial growth factor 145, covering molecular structure, pharmacological properties, receptor interactions,
Vascular Endothelial Growth Factor 165
Comprehensive reference for vascular endothelial growth factor 165, covering molecular structure, pharmacological properties, receptor interactions,
Vascular Endothelial Growth Factor 189
Comprehensive reference for vascular endothelial growth factor 189, covering molecular structure, pharmacological properties, receptor interactions,
Vascular Endothelial Growth Factor 206
Comprehensive reference for vascular endothelial growth factor 206, covering molecular structure, pharmacological properties, receptor interactions,
Vascular Endothelial Growth Factor fragment-1-50
Comprehensive reference for vascular endothelial growth factor fragment-1-50, covering molecular structure, pharmacological properties,
Vascular Endothelial Growth Factor fragment-100-165
Comprehensive reference for vascular endothelial growth factor fragment-100-165, covering molecular structure, pharmacological properties,
Vascular Endothelial Growth Factor fragment-50-100
Comprehensive reference for vascular endothelial growth factor fragment-50-100, covering molecular structure, pharmacological properties,
Vasculitis Peptides: Oligopeptide Research Reference
Peptides associated with Vasculitis including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biolog...
Vasoactive Intestinal Peptide (VIP)
Comprehensive reference for Vasoactive Intestinal Peptide (VIP), a peptide compound with applications in research and therapeutics.
Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...
28-amino acid neuropeptide that causes vasodilation, stimulates intestinal secretion, and has immunomodulatory properties.
Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...
28-amino acid neuropeptide causing vasodilation and chloride secretion in intestine. This neuropeptide is involved in neurological signaling and is studied f...
Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...
A 28-amino acid neuropeptide with potent vasodilatory, secretory, and immunomodulatory effects, acting through VPAC1 and VPAC2 receptors throughout the body.
Vasoactive Intestinal Peptide: Comprehensive Peptide Refe...
VIP is a 28-amino acid neuropeptide mediating vasodilation, secretion, and immune modulation through VPAC1 and VPAC2 receptors.
Vasopressin (AVP): Neuropeptide in Neuroscience Reference
Vasopressin (AVP), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Vasopressin → V1aR: Oligopeptide Research Reference
Vasopressin → V1aR, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Vasopressin → V2R: Oligopeptide Research Reference
Vasopressin → V2R, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Vasopressin 1-5: Peptide Fragment Reference
Comprehensive reference for vasopressin 1-5 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 1-6: Peptide Fragment Reference
Comprehensive reference for vasopressin 1-6 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 1-7: Peptide Fragment Reference
Comprehensive reference for vasopressin 1-7 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 1-8: Peptide Fragment Reference
Comprehensive reference for vasopressin 1-8 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 1-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 1-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 2-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 2-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 3-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 3-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 4-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 4-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 5-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 5-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 6-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 6-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 7-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 7-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin 8-9: Peptide Fragment Reference
Comprehensive reference for vasopressin 8-9 variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin Central Effects: Comprehensive Peptide Reference
Neuropeptide effects on social behavior, aggression, and memory in CNS. This neuropeptide is involved in neurological signaling and is studied for its roles ...
Vasopressin desmopressin: Endogenous Peptide Hormone Refe...
Comprehensive reference for vasopressin desmopressin variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin Family Peptides: Comprehensive Peptide Reference
Guide to vasopressin family peptides including AVP and their roles in water balance and blood pressure. This peptide or oligopeptide is studied for its biolo...
Vasopressin felypressin: Endogenous Peptide Hormone Refer...
Comprehensive reference for vasopressin felypressin variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin Hormone: Endogenous Peptide Hormone Reference
Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Vasopressin Intramolecular (Disulfide Bond)
Comprehensive reference for Vasopressin Intramolecular (Disulfide Bond), a peptide compound with applications in research and therapeutics.
Vasopressin lypressin: Endogenous Peptide Hormone Reference
Comprehensive reference for vasopressin lypressin variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin ornipressin: Endogenous Peptide Hormone Refer...
Comprehensive reference for vasopressin ornipressin variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin Pair Bonding: Neuropeptide in Neuroscience Re...
Vasopressin V1a effects on male pair bonding and paternal behavior. This neuropeptide is involved in neurological signaling and is studied for its roles in b...
Vasopressin Peptide Hormone: Comprehensive Peptide Reference
Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Vasopressin Protein Hormone: Comprehensive Peptide Reference
Vasopressin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinica...
Vasopressin terlipressin: Endogenous Peptide Hormone Refe...
Comprehensive reference for vasopressin terlipressin variant, covering molecular structure, pharmacological properties, receptor interactions,
Vasopressin V1 Agonist: Oligopeptide Research Reference
vasopressin V1 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Vasopressin V2 Agonist: Oligopeptide Research Reference
vasopressin V2 agonist in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potent...
Vasopressin: Endogenous Peptide Hormone Reference
A 9-amino acid neuropeptide hormone from the posterior pituitary that regulates water balance, blood pressure, and social behavior, with clinical analogs inc...
Vasopressin: Oligopeptide Research Reference
vasopressin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applica...
VEGF A Hormone: Endogenous Peptide Hormone Reference
VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF A Peptide Hormone: Endogenous Peptide Hormone Reference
VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF A Protein Hormone: Endogenous Peptide Hormone Reference
VEGF A, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF C Hormone: Endogenous Peptide Hormone Reference
VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF C Peptide Hormone: Endogenous Peptide Hormone Reference
VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF C Protein Hormone: Endogenous Peptide Hormone Reference
VEGF C, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF D Hormone: Endogenous Peptide Hormone Reference
VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF D Peptide Hormone: Endogenous Peptide Hormone Reference
VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF D Protein Hormone: Endogenous Peptide Hormone Reference
VEGF D, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical sig...
VEGF Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting VEGF Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure...
VEGFR Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting VEGFR Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structur...
VEGFR Inhibitor: Oligopeptide Research Reference
VEGFR inhibitor in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential app...
Venom AMP Cross-Function: Antimicrobial Peptide Reference
Antimicrobial properties of animal venom peptides beyond toxic functions. This antimicrobial peptide demonstrates activity against pathogens and is studied f...
Venom Peptide / G-protein Activator
Venom Peptide / G-protein Activator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Venom Peptide / Growth Inhibitor
Venom Peptide / Growth Inhibitor is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological acti...
Venom Peptide / Hypotensive: Comprehensive Peptide Reference
Venom Peptide / Hypotensive is a bioactive compound with applications in peptide research and therapeutics. This peptide or oligopeptide is studied for its b...
Venom Peptide / Mast Cell Activator
Venom Peptide / Mast Cell Activator is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Venom Peptide / Membrane Disruption
Venom Peptide / Membrane Disruption is a bioactive compound with applications in peptide research and therapeutics. Covers molecular mechanisms, biological a...
Venom Peptide Drug Development
Clinical development of venom-derived peptides as therapeutic agents. This peptide toxin is derived from venom and studied for its pharmacological activity, ...
Venom Peptide Engineering: Comprehensive Peptide Reference
Rational modification of venom peptides for improved therapeutic properties. This peptide toxin is derived from venom and studied for its pharmacological act...
Venom Peptide Evolution: Peptide Toxin in Pharmacology Re...
Evolutionary biology of venom peptide gene families. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of acti...
Venom Peptide Formulation: Comprehensive Peptide Reference
Formulation strategies for venom peptide therapeutics including lyophilization. This peptide toxin is derived from venom and studied for its pharmacological ...
Venom Peptide Omics: Peptide Toxin in Pharmacology Reference
Proteomics and peptidomics approaches for venom peptide discovery. This peptide toxin is derived from venom and studied for its pharmacological activity, mec...
Venom Peptide Pharmacokinetics
Pharmacokinetic properties of venom-derived therapeutic peptides. This peptide toxin is derived from venom and studied for its pharmacological activity, mech...
Venom Peptide Pharmacology: Comprehensive Peptide Reference
General pharmacology of venom peptides as ion channel and receptor modulators. This peptide toxin is derived from venom and studied for its pharmacological a...
Venom Peptide Safety Profile: Comprehensive Peptide Refer...
Safety considerations for venom peptide therapeutics in clinical development. This peptide toxin is derived from venom and studied for its pharmacological ac...
Venom Peptide Selectivity: Comprehensive Peptide Reference
Structural basis for venom peptide selectivity for biological targets. This peptide toxin is derived from venom and studied for its pharmacological activity,...
Venom Peptide Stability: Peptide Toxin in Pharmacology Re...
Strategies for improving venom peptide stability and bioavailability. This peptide toxin is derived from venom and studied for its pharmacological activity, ...
Venom Peptides: Oligopeptide Research Reference
Neurotoxic, cytotoxic, antimicrobial. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Vesicle Assembly System 1: Comprehensive Peptide Reference
A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Vesicle Assembly System 2: Comprehensive Peptide Reference
A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Vesicle Assembly System 3: Comprehensive Peptide Reference
A vesicle-assembly-based peptide delivery system designed for enhanced bioavailability and therapeutic efficacy.. This innovative approach addresses key chal...
Vestronidase Alfa: Oligopeptide Research Reference
Vestronidase Alfa, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
VHH antibody: Oligopeptide Research Reference
Comprehensive reference for vhh antibody, covering molecular structure, pharmacological properties, receptor interactions,
VHL Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting VHL Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Vicilin: Oligopeptide Research Reference
Vicilin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Viltolarsen: Oligopeptide Research Reference
Viltolarsen, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Vimentin intermediate filament
Comprehensive reference for vimentin intermediate filament, covering molecular structure, pharmacological properties, receptor interactions,
Vinpocetine: Endogenous Peptide Hormone Reference
vinpocetine is an analog or modulator of oxytocin signaling used in obstetric and other clinical applications. This peptide or oligopeptide is studied for it...
Vinyl Sulfone Purification: Comprehensive Peptide Reference
A purification technique for separating and isolating peptides using Vinyl Sulfone. This analytical technique provides valuable insights into peptide structu...
Violacein: Oligopeptide Research Reference
violacein is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologica...
Violacin A: Oligopeptide Research Reference
violacin-A is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...
Violacin B: Oligopeptide Research Reference
violacin-B is a cyclotide — a cyclic, knotted peptide from plants with exceptional stability and insecticidal activity. Covers molecular mechanisms, biologic...
VIP 1-12: Peptide Fragment Reference
Comprehensive reference for VIP 1-12 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 1-18: Peptide Fragment Reference
Comprehensive reference for VIP 1-18 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 1-22: Peptide Fragment Reference
Comprehensive reference for VIP 1-22 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 1-25: Peptide Fragment Reference
Comprehensive reference for VIP 1-25 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 1-28: Peptide Fragment Reference
Comprehensive reference for VIP 1-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 10-28: Peptide Fragment Reference
Comprehensive reference for VIP 10-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 13-28: Peptide Fragment Reference
Comprehensive reference for VIP 13-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 16-28: Peptide Fragment Reference
Comprehensive reference for VIP 16-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 18-28: Peptide Fragment Reference
Comprehensive reference for VIP 18-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 21-28: Peptide Fragment Reference
Comprehensive reference for VIP 21-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 22-28: Peptide Fragment Reference
Comprehensive reference for VIP 22-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 25-28: Peptide Fragment Reference
Comprehensive reference for VIP 25-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP 7-28: Peptide Fragment Reference
Comprehensive reference for VIP 7-28 variant, covering molecular structure, pharmacological properties, receptor interactions,
VIP Family Peptides: Oligopeptide Research Reference
Learn about vasoactive intestinal peptide and related peptides in vasodilation and immune regulation. This peptide or oligopeptide is studied for its biologi...
VIP Fragment: Oligopeptide Research Reference
VIP fragment in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
VIP Hormone: Endogenous Peptide Hormone Reference
VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
VIP Peptide Hormone: Endogenous Peptide Hormone Reference
VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
VIP Protein Hormone: Endogenous Peptide Hormone Reference
VIP, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical signif...
VIP/Secretin family: Neuropeptide in Neuroscience Reference
VIP/Secretin family is a bioactive compound with applications in peptide research and therapeutics. This neuropeptide is involved in neurological signaling a...
Virotoxins: Oligopeptide Research Reference
Virotoxins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Viscumin: Oligopeptide Research Reference
Viscumin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Visfatin Hormone: Endogenous Peptide Hormone Reference
Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Visfatin Peptide Hormone: Endogenous Peptide Hormone Refe...
Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Visfatin Protein Hormone: Endogenous Peptide Hormone Refe...
Visfatin, an endogenous hormone involved in endocrine signaling, covering molecular structure, receptor pharmacology, physiological functions, and clinical s...
Vitamin D (25-OH): Oligopeptide Research Reference
25-hydroxyvitamin D. Vitamin D status marker. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and pote...
VMD: Oligopeptide Research Reference
Visual Molecular Dynamics software for molecular visualization and analysis. This peptide or oligopeptide is studied for its biological activity, structure-a...
VPP: Oligopeptide Research Reference
Valine-proline-proline. ACE-inhibitory tripeptide from milk. Contributes to antihypertensive effects of dairy. This peptide or oligopeptide is studied for it...
VSTx1: Peptide Toxin in Pharmacology Reference
VSTx1 is a spider venom peptide with specific ion channel or receptor blocking properties. This peptide toxin is derived from venom and studied for its pharm...
Walnut Peptide: Oligopeptide Research Reference
A bioactive peptide derived from walnut with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Wasp Venom AMPs: Peptide Toxin in Pharmacology Reference
AMPs from wasp venom providing innate defense and prey immobilization. This peptide toxin is derived from venom and studied for its pharmacological activity,...
Wasp Venom Antimicrobial: Peptide Toxin in Pharmacology R...
Antimicrobial properties of wasp venom peptides for infectious disease. This peptide toxin is derived from venom and studied for its pharmacological activity...
Wasp Venom Bioactive Peptides: Comprehensive Peptide Refe...
Discovery and characterization of bioactive peptides from wasp venoms. This peptide toxin is derived from venom and studied for its pharmacological activity,...
Wasp Venom Brachykinin: Peptide Toxin in Pharmacology Ref...
Kinins from wasp venom causing pain and vasodilation. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of act...
Wasp Venom Cancer Targets: Comprehensive Peptide Reference
Molecular targets of wasp venom peptides in cancer cells. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanism of...
Wasp Venom Phospholipase: Peptide Toxin in Pharmacology R...
Phospholipase enzymes from wasp venom contributing to tissue damage. This peptide toxin is derived from venom and studied for its pharmacological activity, m...
Wasp Venom Polybia-CP: Peptide Toxin in Pharmacology Refe...
Antimicrobial peptide from Polybia wasp venom with broad-spectrum activity. This peptide toxin is derived from venom and studied for its pharmacological acti...
Wasp Venom Polybia-MP1: Peptide Toxin in Pharmacology Ref...
Membrane-disrupting peptide from Polybia paulista wasp venom. This peptide toxin is derived from venom and studied for its pharmacological activity, mechanis...
Watermelon Peptide: Oligopeptide Research Reference
A bioactive peptide derived from watermelon with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-ac...
Waters Xevo G2-XS QTof: Oligopeptide Research Reference
Quadrupole time-of-flight mass spectrometer for peptide identification. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Well Tempered for Peptides: Comprehensive Peptide Reference
A computational method for studying peptides using Well Tempered. This analytical technique provides valuable insights into peptide structure, purity, and ch...
Western Blot Analysis: Analytical Technique in Peptide Re...
An analytical technique for characterizing peptides using Western Blot. This analytical technique provides valuable insights into peptide structure, purity, ...
Western Blot for Peptides: Comprehensive Peptide Reference
Understand western blotting techniques for detecting and semi-quantifying peptides using gel electrophoresis and immunodetection.
WF11899A: Oligopeptide Research Reference
WF11899A, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Wheat Gluten Exorphin: Oligopeptide Research Reference
wheat gluten exorphin in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potenti...
Wheat Peptide: Oligopeptide Research Reference
A bioactive peptide derived from wheat with potential health benefits. This peptide or oligopeptide is studied for its biological activity, structure-activit...
Whitewater Arroyo N Vaccine: Comprehensive Peptide Reference
A peptide vaccine targeting Whitewater Arroyo N for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, struc...
WHO ICTRP: Oligopeptide Research Reference
WHO International Clinical Trials Registry Platform. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, a...
WHO Prequalification for Peptides
Understand WHO prequalification program requirements for peptide medicines in global health markets. This peptide or oligopeptide is studied for its biologic...
Wickerhamomyces anomalus: Oligopeptide Research Reference
Binds β-1,3-glucan, disrupts cell wall. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
WNT Inhibitor PDC: Oligopeptide Research Reference
A peptide-drug conjugate targeting WNT Inhibitor for selective drug delivery. This peptide or oligopeptide is studied for its biological activity, structure-...
Wnt Modulator: Oligopeptide Research Reference
Wnt modulator in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential appli...
Wnt Pathway Peptide 1: Oligopeptide Research Reference
A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Wnt Pathway Peptide 2: Oligopeptide Research Reference
A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Wnt Pathway Peptide 3: Oligopeptide Research Reference
A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Wnt Pathway Peptide 4: Oligopeptide Research Reference
A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Wnt Pathway Peptide 5: Oligopeptide Research Reference
A peptide involved in the Wnt signal transduction pathway, playing roles in cell proliferation, differentiation, or survival.
Word2vec for Peptides: Analytical Technique in Peptide Re...
A computational method for studying peptides using Word2vec. This analytical technique provides valuable insights into peptide structure, purity, and charact...
Wound Healing AMPs: Antimicrobial Peptide Reference
Antimicrobial peptides contributing to wound healing through multiple mechanisms. This antimicrobial peptide demonstrates activity against pathogens and is s...
Wound Healing and Peptides: Comprehensive Peptide Reference
Learn about growth factor peptides and antimicrobial peptides that accelerate wound healing and tissue repair. This peptide or oligopeptide is studied for it...
Wound Healing: Oligopeptide Research Reference
Peptide-based wound healing approaches. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ...
Wound Infection: Oligopeptide Research Reference
Microbial contamination of wounds. Can delay healing. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, ...
X Ray Crystal Analysis: Analytical Technique in Peptide R...
An analytical technique for characterizing peptides using X Ray Crystal. This analytical technique provides valuable insights into peptide structure, purity,...
X-ray Crystallography for Peptides
Understand X-ray crystallography methods for resolving atomic-level peptide structures from crystalline samples. Covers molecular mechanisms, biological acti...
X-ray crystallography techniques, protein folding studies
X-ray crystallography techniques, protein folding studies is a bioactive compound with applications in peptide research and therapeutics.
X-ray Crystallography: Analytical Technique in Peptide Re...
>. This analytical technique provides valuable insights into peptide structure, purity, and characterization, supporting quality control and research in pept...
X-ray for Peptides: Analytical Technique in Peptide Research
Application of X-ray technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biologi...
Xenopins: Antimicrobial Peptide Reference
xenopins is an antimicrobial peptide from amphibian skin with broad-spectrum antimicrobial activity. This antimicrobial peptide demonstrates activity against...
xerogel for Peptides: Analytical Technique in Peptide Res...
Application of xerogel technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for its biolo...
XLNet for Peptides: Analytical Technique in Peptide Research
A computational method for studying peptides using XLNet. This analytical technique provides valuable insights into peptide structure, purity, and characteri...
Xultophy Degludec-Liraglutide: Comprehensive Peptide Refe...
Fixed-ratio combination of insulin degludec and GLP-1 agonist liraglutide for once-daily injection. This peptide or oligopeptide is studied for its biologica...
Y Pestis Peptide: Oligopeptide Research Reference
A peptide associated with Y Pestis for research or therapeutic applications. This peptide or oligopeptide is studied for its biological activity, structure-a...
YouTube Peptide Synthesis: Comprehensive Peptide Reference
Educational video resource on peptide synthesis techniques. This peptide or oligopeptide is studied for its biological activity, structure-activity relations...
YP-001: Oligopeptide Research Reference
YIIKGVFWDPAC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
YP-003: Oligopeptide Research Reference
WHWLQLKPGQPMY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
YP-005: Oligopeptide Research Reference
MKFFSAALTLAAAVAG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
YP-007: Oligopeptide Research Reference
YIIKGVFWDPAC-Far. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
YP-009: Oligopeptide Research Reference
WHWLQLKPGQPMD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
YP-011: Oligopeptide Research Reference
AKIGLGYAQKIVNRAQKYKRQIGGPNFNKLCQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
YP-013: Oligopeptide Research Reference
ISNGLNGCQFANKGQYYCTCK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
YP-015: Oligopeptide Research Reference
ANLCNLCKNKGQYYCQCK. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biom...
YP-017: Oligopeptide Research Reference
NLCGKCKNKSGYYCTC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
YP-019: Oligopeptide Research Reference
CSWACKNKGQYYCQC. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedi...
YP-021: Oligopeptide Research Reference
DSHAKRHHGYKRKFHEKHHSHRGY. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications i...
YP-023: Oligopeptide Research Reference
KCNNGQYCNRGICFCQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomed...
YP-025: Oligopeptide Research Reference
AGRGKQGGKVRAKAKTRSS. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in bio...
YP-027: Oligopeptide Research Reference
LNQSNLPAISYD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical...
YP-029: Oligopeptide Research Reference
(2S,3R,4R,6E)-2-amino-3,4-dihydroxy-2-hydroxymethyl-14-oxo-6-eicosenoic acid derivative. This peptide or oligopeptide is studied for its biological activity,...
YP-031: Oligopeptide Research Reference
MSAQNDKVDLDDDVAQD. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biome...
YP-033: Oligopeptide Research Reference
RFSFKKLSGSGFG. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedica...
YP-035: Oligopeptide Research Reference
AQNLNSFIKQYGDV. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedic...
Zagotenemab: Oligopeptide Research Reference
Zagotenemab, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Zavegepant - First-in-Human (NCT02823622)
First-in-human trial of zavegepant for migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and p...
Zavegepant - Migraine (NCT03872453)
Phase III trial of zavegepant for acute migraine. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and ...
Zavegepant: Oligopeptide Research Reference
Intranasal CGRP receptor antagonist for acute migraine with rapid onset via nasal absorption. This peptide or oligopeptide is studied for its biological acti...
Zebrafish NPY: Oligopeptide Research Reference
Zebrafish NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
Zeta Analysis: Analytical Technique in Peptide Research
An analytical technique for characterizing peptides using Zeta. This analytical technique provides valuable insights into peptide structure, purity, and char...
zeta-potential for Peptides: Comprehensive Peptide Reference
Application of zeta-potential technique for peptide characterization, structure determination, or formulation. This peptide or oligopeptide is studied for it...
Ziconotide - Pain (NCT00000125)
Trial of ziconotide for chronic pain. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential ap...
Ziconotide: Oligopeptide Research Reference
Synthetic omega-conotoxin MVIIA that blocks N-type calcium channels in the spinal cord for severe chronic pain management.
Ziconotide: Oligopeptide Research Reference
Ziconotide is a synthetic omega-conotoxin MVIIA peptide that blocks N-type calcium channels, approved for severe chronic pain via intrathecal delivery.
Zika E Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Zika E for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activity...
Zika NS1 Vaccine: Oligopeptide Research Reference
A peptide vaccine targeting Zika NS1 for infectious disease prevention. This peptide or oligopeptide is studied for its biological activity, structure-activi...
Zika Peptides: Oligopeptide Research Reference
Peptides associated with Zika including biomarkers, therapeutic targets, and diagnostic markers. This peptide or oligopeptide is studied for its biological a...
Zinc Peptide: Oligopeptide Research Reference
zinc peptide in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
Zinc-Binding Group Peptides: Comprehensive Peptide Reference
Peptides containing zinc-binding pharmacophores for metalloprotease inhibition including hydroxamates, carboxylates, and thiols.
Zoledronic Acid: Oligopeptide Research Reference
Nitrogen-containing bisphosphonate that inhibits farnesyl pyrophosphate synthase, used for osteoporosis and bone metastases.
Zosuquidar: Oligopeptide Research Reference
zosuquidar in peptide research. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applicat...
Zwitterionic guanidinium compound
Alexandrium tamarense. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in b...
α-Bungarotoxin: Peptide Toxin in Pharmacology Reference
α-Bungarotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
α-Cobrotoxin: Oligopeptide Research Reference
α-Cobrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
α-Conotoxin GI: Peptide Toxin in Pharmacology Reference
α-Conotoxin GI, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
α-Conotoxin MI: Peptide Toxin in Pharmacology Reference
α-Conotoxin MI, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
α-Conotoxin Vc1.1: Oligopeptide Research Reference
α-Conotoxin Vc1.1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
α-Lactorphin: Oligopeptide Research Reference
Opioid peptide derived from β-lactoglobulin. Found in milk. Has analgesic activity. This peptide or oligopeptide is studied for its biological activity, stru...
α-Latrotoxin: Peptide Toxin in Pharmacology Reference
α-Latrotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
δ-Conotoxin SVIA: Peptide Toxin in Pharmacology Reference
δ-Conotoxin SVIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
δ-Palutoxins (δ-PalUTx-1, -2, -3, -4)
Comprehensive reference for δ-Palutoxins (δ-PalUTx-1, -2, -3, -4), a peptide compound with applications in research and therapeutics.
δ-Palutoxins: Peptide Toxin in Pharmacology Reference
δ-Palutoxins, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
κ-Conotoxin PVIIA: Peptide Toxin in Pharmacology Reference
κ-Conotoxin PVIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
μ-Conotoxin GIIIA: Peptide Toxin in Pharmacology Reference
μ-Conotoxin GIIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
μ-Conotoxin KIIIA: Peptide Toxin in Pharmacology Reference
μ-Conotoxin KIIIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
µg-mg: Oligopeptide Research Reference
Medium. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical resea...
µg: Oligopeptide Research Reference
Low. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applications in biomedical research...
χ-Conotoxin MrIA: Oligopeptide Research Reference
χ-Conotoxin MrIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ω-Agatoxin IVA: Peptide Toxin in Pharmacology Reference
ω-Agatoxin IVA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ω-Agatoxin TK: Peptide Toxin in Pharmacology Reference
ω-Agatoxin TK, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ω-Conotoxin GVIA: Peptide Toxin in Pharmacology Reference
ω-Conotoxin GVIA, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
ω-Conotoxin MVIIA (Ziconotide)
Comprehensive reference for ω-Conotoxin MVIIA (Ziconotide), a peptide compound with applications in research and therapeutics.
ω-Conotoxin: Oligopeptide Research Reference
ω-Conotoxin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
No peptides match your search.