Worm Peptides intermediate
INS-1 (C. elegans): Oligopeptide Research Reference
INS-1 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
INS-1 (C. elegans) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Caenorhabditis elegans.
Structure
| Property | Value |
|---|---|
| Name | INS-1 (C. elegans) |
| Sequence | MKLLVLIVFLLISAHADTILTKLCGSHLVDALYFVCGDRGFYQNKICGSDLVSLWQQLMPY |
| Length | 59 amino acids |
| Molecular Weight | 6580 Da |
| Source | Caenorhabditis elegans |
| Category | Nematode Insulin-like Peptide |
Mechanism of Action
Agonist of DAF-2 receptor, activates PI3K/AGE-1 signaling cascade, promotes phosphorylation of DAF-16/FOXO
Bioactivity
Promotes dauer exit, reproductive growth, and lifespan regulation
Therapeutic Potential
Aging and longevity research, insulin signaling pathway studies
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about INS-1 (C. elegans): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept