Insect Peptides intermediate
Royalisin (Apis): Oligopeptide Research Reference
Royalisin (Apis), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
insect-peptides peptide oligopeptide
Overview
Royalisin (Apis) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Apis mellifera (honeybee).
Structure
| Property | Value |
|---|---|
| Name | Royalisin (Apis) |
| Sequence | VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKCSPI |
| Length | 51 amino acids |
| Molecular Weight | 5520 Da |
| Source | Apis mellifera (honeybee) |
| Category | Insect Defensin / Antimicrobial |
Mechanism of Action
Disrupts bacterial cell wall synthesis, binds peptidoglycan
Bioactivity
Antimicrobial against Gram-positive bacteria, abundant in royal jelly
Therapeutic Potential
Food preservation, anti-infective agents, wound care
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Royalisin (Apis): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept