Toxin Peptides intermediate
Css II (CssIV): Peptide Toxin in Pharmacology Reference
Css II (CssIV), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
sodium-channel-activator-(α-scorpion-toxin) peptide oligopeptide
Overview
Css II (CssIV) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Css II (CssIV) |
| Sequence | KEGYLVNADYTCPASFLQKGYCQTLFCYCKKKGHGGYCQWEKGYCWCTK (partial) |
| Length | 59 amino acids |
| Category | Sodium channel activator (α-scorpion toxin) |
Structure
Css II (CssIV) belongs to the Sodium channel activator (α-scorpion toxin) class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Css II (CssIV) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: venom-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Css II (CssIV): Peptide Toxin in Pharmacology Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept