Reptile Peptides intermediate
Exendin-4: Oligopeptide Research Reference
Exendin-4, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
reptile-peptides peptide oligopeptide
Overview
Exendin-4 is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Exendin-4 |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Molecular Weight | 4187 Da |
| Category | Metabolic / GLP-1 Agonist |
Mechanism of Action
GLP-1 receptor agonist; resistant to DPP-4 degradation due to Ala at position 2
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Exendin-4: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept