Potassium channel blocker (sea anemone toxin) intermediate
ShK (Stichodactyla helianthus K+ channel toxin)
Comprehensive reference for ShK (Stichodactyla helianthus K+ channel toxin), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
potassium-channel-blocker-(sea-anemone-toxin) peptide oligopeptide
Overview
ShK (Stichodactyla helianthus K+ channel toxin) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | ShK (Stichodactyla helianthus K+ channel toxin) |
| Sequence | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRCTKLC |
| Length | 34 amino acids |
| Molecular Weight | 4054 Da |
| Category | Potassium channel blocker (sea anemone toxin) |
Structure
ShK (Stichodactyla helianthus K+ channel toxin) belongs to the Potassium channel blocker (sea anemone toxin) class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
ShK (Stichodactyla helianthus K+ channel toxin) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: venom-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about ShK (Stichodactyla helianthus K+ channel toxin) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept