GLP-1 Family intermediate
GLP-1 as DPP-4 Substrate: Peptide Family Reference
Mechanism of DPP-4-mediated GLP-1 degradation and how therapeutic analogues overcome this limitation. This peptide or oligopeptide is studied for its biologi...
By Encyclopeptide Editorial | 1 min read
GLP-1 DPP-4 substrate degradation incretin
DPP-4 Mechanism
Enzyme Characteristics
- Type: Serine exopeptidase
- Expression: Soluble (plasma) and membrane-bound forms
- Substrate preference: Cleaves after Pro or Ala at P1 position
Cleavage Site
Native GLP-1: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
|| DPP-4 cleavage
Inactive: EG TFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
Strategies to Overcome DPP-4
| Strategy | Example | Half-life Extension |
|---|---|---|
| Aib substitution at position 8 | Semaglutide | Resistant to DPP-4 |
| Gly2 substitution | Exenatide | Partially resistant |
| Albumin binding | Liraglutide | Indirect |
Chemical Identity
| Property | Value |
|---|---|
| Name | GLP-1 as DPP-4 Substrate |
| Category | GLP-1 Family |
Biological Significance
This molecule plays important roles in biological systems and has potential therapeutic applications.
References
- Encyclopeptide Database. “GLP-1 as DPP-4 Substrate” monograph. encyclopeptide.com.
Test Your Knowledge
Reinforce what you learned about GLP-1 as DPP-4 Substrate: Peptide Family Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept