GLP-1 Family intermediate
GLP-1(7-36)amide: Peptide Family Reference
The primary bioactive form of GLP-1, a 30-amino acid peptide amide produced by intestinal L-cells. This peptide or oligopeptide is studied for its biological...
By Encyclopeptide Editorial | 1 min read
GLP-1 GLP-1-7-36 incretin L-cells bioactive
Chemical Identity
| Property | Value |
|---|---|
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Length | 31 amino acids |
| Molecular Weight | 3298.5 Da |
| Form | C-terminal amide |
Metabolism
Rapidly degraded by DPP-4, which cleaves the N-terminal His-Ala dipeptide, producing inactive GLP-1(9-36)amide. This rapid degradation limits native GLP-1’s therapeutic utility.
Biological Significance
This molecule plays important roles in biological systems and has potential therapeutic applications.
References
- Encyclopeptide Database. “GLP-1(7-36)amide” monograph. encyclopeptide.com.
Test Your Knowledge
Reinforce what you learned about GLP-1(7-36)amide: Peptide Family Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept