Plant Peptides intermediate
Lunasin: Oligopeptide Research Reference
Lunasin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Lunasin is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Glycine max (Soybean).
Structure
| Property | Value |
|---|---|
| Name | Lunasin |
| Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Length | 43 amino acids |
| Molecular Weight | ~5,000 Da |
| Source | Glycine max (Soybean) |
| Category | Plant Bioactive Peptides |
Mechanism of Action
Inhibits histone acetylation, disrupts mitosis, induces apoptosis in cancer cells
Bioactivity
Anti-cancer, anti-inflammatory
Therapeutic Potential
Cancer chemoprevention, nutraceutical development, epigenetic therapy
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Lunasin: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept