Skip to content
Antimicrobial Peptides intermediate

LL-37: Antimicrobial Peptide Reference

Only human cathelicidin antimicrobial peptide, providing broad-spectrum defense and immunomodulatory functions at mucosal surfaces.

By Encyclopeptide Editorial | 2 min read
cathelicidin antimicrobial-peptide innate-immunity immunomodulatory

Chemical Identity

PropertyValue
GeneCAMP (hCAP18)
Molecular Weight4493 Da
Amino Acids37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES)
Peptide ClassCathelicidin (Alpha-helical AMP)
SourceNeutrophils, epithelial cells

Structure

LL-37 is the only cathelicidin family antimicrobial peptide in humans, derived from the C-terminal end of the hCAP18 precursor protein. It is a 37-amino acid amphipathic alpha-helical peptide starting with two leucine residues (hence the name). It adopts an alpha-helical conformation in membrane-mimetic environments.

Mechanism of Action

LL-37 disrupts bacterial membranes through its amphipathic helical structure, with cationic residues binding anionic phospholipids and hydrophobic residues inserting into the lipid bilayer. Beyond direct killing, it has potent immunomodulatory effects: chemotaxis of neutrophils, monocytes, and T cells; promotion of wound healing; and modulation of inflammatory cytokine expression.

Clinical Applications

  • Innate immune defense: Broad-spectrum antimicrobial (gram-positive, gram-negative, fungi)
  • Wound healing: Promotes re-epithelialization and angiogenesis
  • Cystic fibrosis: Deficient in CF airways, therapeutic potential
  • Psoriasis: Overexpressed in psoriatic lesions
  • Cancer: Anti-tumor activity under investigation

Pharmacology

  • Spectrum: Broad (bacteria, fungi, enveloped viruses)
  • Salt sensitivity: Partially sensitive to NaCl
  • Biofilm disruption: Active against bacterial biofilms
  • Anti-endotoxin: Neutralizes LPS

References

  • Gudmundsson, G.H., et al. (1996). The human gene FALL39 and processing of the cathelin precursor. Journal of Biological Chemistry, 271, 2447-2454.
  • Zanetti, M. (2004). Cathelicidins, multifunctional peptides of the innate immunity. Journal of Leukocyte Biology, 75, 39-48.

Test Your Knowledge

Reinforce what you learned about LL-37: Antimicrobial Peptide Reference with interactive quizzes on Wikipept.

Take a Quiz on Wikipept