Amylin: Endogenous Peptide Hormone Reference
37-amino acid peptide hormone co-secreted with insulin from pancreatic beta cells, regulating gastric emptying and glucagon.
Chemical Identity
| Property | Value |
|---|---|
| Chemical Formula | C169H267N51O52S2 |
| Molecular Weight | 3903 Da |
| CAS Number | 122384-88-7 |
| Peptide Class | Polypeptide Hormone (37 amino acids) |
| Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
| Disulfide Bonds | 1 (Cys2-Cys7) |
Structure
Amylin (islet amyloid polypeptide, IAPP) is a 37-amino acid peptide hormone with a disulfide bridge between Cys2 and Cys7 and a C-terminal amidation. It is co-secreted with insulin from pancreatic beta cell secretory granules at a fixed 1:100 ratio to insulin.
Mechanism of Action
Amylin acts through amylin receptors (calcitonin receptor with RAMP1, RAMP2, or RAMP3) in the area postrema and nucleus tractus solitarius. It suppresses postprandial glucagon secretion, slows gastric emptying, and promotes satiety through central vagal afferents. These actions complement insulin in postprandial glucose regulation.
Clinical Applications
- Type 1 diabetes: Deficient amylin secretion (supplemental therapy)
- Type 2 diabetes: Reduced amylin response (adjunct to insulin)
- Pramlintide: Synthetic analog for clinical use
- Obesity: Appetite suppression mechanism
Pharmacology
- Co-secretion: Released with insulin in response to nutrients
- Ratio: 1:100 amylin:insulin
- Deficiency: Absent in type 1 diabetes, reduced in type 2
- Amyloid: Aggregation contributes to beta cell death in T2DM
References
- Cooper, G.J., et al. (1987). Purification and characterization of amylin from amyloid-rich pancreases. Proceedings of the National Academy of Sciences, 84, 8628-8632.
- Young, A. (2005). Inhibition of glucagon secretion by amylin. Diabetes, 54, 1548-1555.
Test Your Knowledge
Reinforce what you learned about Amylin: Endogenous Peptide Hormone Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept