Therapeutic Peptides intermediate
Pramlintide: Oligopeptide Research Reference
Pramlintide, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
therapeutic-peptides peptide oligopeptide
Overview
Pramlintide is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Pramlintide |
| Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
| Length | 37 amino acids |
| Molecular Weight | 3950 Da |
| Category | Metabolic / Amylin Analog |
Mechanism of Action
Amylin receptor agonist; slows gastric emptying, suppresses glucagon
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Pramlintide: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept