Plant Peptides intermediate
Soyacystatin: Oligopeptide Research Reference
Soyacystatin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Soyacystatin is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Glycine max (Soybean).
Structure
| Property | Value |
|---|---|
| Name | Soyacystatin |
| Sequence | QVVAGTNYYILRAGLPPYQPVHFGGSGCGA |
| Length | ~120 amino acids |
| Molecular Weight | ~13,000 Da |
| Source | Glycine max (Soybean) |
| Category | Plant Bioactive Peptides |
Mechanism of Action
Competitive inhibition via tight-binding mechanism
Bioactivity
Cysteine protease inhibitor
Therapeutic Potential
Anti-parasitic therapy, anti-cancer applications, food preservation
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Soyacystatin: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept