Neuropeptides intermediate
Neuropeptide Y (NPY): Neuropeptide in Neuroscience Reference
Neuropeptide Y (NPY), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
neuropeptides peptide oligopeptide
Overview
Neuropeptide Y (NPY) is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Neuropeptide Y (NPY) |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Length | 36 amino acids |
| Molecular Weight | 4253.8 Da |
| Category | Neuropeptide Y family |
Mechanism of Action
Gi/Go-coupled; inhibits adenylyl cyclase, modulates Ca2+ and K+ channels
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Neuropeptide Y (NPY): Neuropeptide in Neuroscience Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept