Avian Cathelicidin intermediate
Ostrich Cathelicidin (SdCATH)
Comprehensive reference for Ostrich Cathelicidin (SdCATH), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-cathelicidin peptide oligopeptide
Overview
Ostrich Cathelicidin (SdCATH) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Ostrich Cathelicidin (SdCATH) |
| Sequence | RFGRRFLRLFRRIRRFRPKVTITIQGSARFG |
| Length | 31 amino acids |
| Molecular Weight | 3600 Da |
| Category | Avian Cathelicidin |
Structure
Ostrich Cathelicidin (SdCATH) belongs to the Avian Cathelicidin class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Ostrich Cathelicidin (SdCATH) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Ostrich Cathelicidin (SdCATH) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept