Enfuvirtide: Oligopeptide Research Reference
Synthetic 36-amino acid peptide HIV fusion inhibitor that blocks gp41-mediated viral entry into CD4 cells. This peptide or oligopeptide is studied for its bi...
Chemical Identity
| Property | Value |
|---|---|
| Chemical Formula | C204H301N51O64 |
| Molecular Weight | 4492 Da |
| CAS Number | 159519-65-0 |
| Peptide Class | Synthetic Linear Peptide (36 amino acids) |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Route | SC injection |
Structure
Enfuvirtide (T-20, Fuzeon) is a synthetic 36-amino acid peptide corresponding to a region of the HIV-1 gp41 transmembrane glycoprotein. It mimics the C-terminal heptad repeat region of gp41 that binds to the N-terminal heptad repeat, preventing the conformational change required for membrane fusion.
Mechanism of Action
During HIV entry, gp41 undergoes a conformational change exposing the N-terminal and C-terminal heptad repeat regions, which fold into a six-helix bundle that drives membrane fusion. Enfuvirtide binds to the N-terminal heptad repeat, preventing six-helix bundle formation and blocking the final step of viral-cell membrane fusion.
Clinical Applications
- HIV-1 infection: Treatment-experienced patients with multidrug-resistant virus (Fuzeon)
- TROTORO and TORO trials: Significant viral load reduction in heavily pretreated patients
- Salvage therapy: When other antiretroviral options exhausted
- Bridge therapy: While awaiting other treatment options
Pharmacokinetics
- Half-life: 3.8 hours
- Tmax: 4-8 hours (SC)
- Bioavailability: 84% (SC)
- Metabolism: Proteolytic degradation
- Dosing: 90 mg SC twice daily
- Route: SC injection (thigh, abdomen, upper arm)
Safety and Side Effects
Injection site reactions (98%, most common reason for discontinuation), bacterial pneumonia (increased risk), insomnia, depression, peripheral neuropathy, and eosinophilia. Requires proper injection technique training.
References
- Lalezari, J.P., et al. (2003). T-20 versus optimized background regimen for HIV. New England Journal of Medicine, 348, 2175-2185.
- Kilby, J.M., et al. (1998). Peptide T-20 inhibitor of HIV-1 fusion. Nature Medicine, 4, 1302-1307.
Test Your Knowledge
Reinforce what you learned about Enfuvirtide: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept