Yeast Peptides intermediate
YP-011: Oligopeptide Research Reference
AKIGLGYAQKIVNRAQKYKRQIGGPNFNKLCQ. This peptide or oligopeptide is studied for its biological activity, structure-activity relationships, and potential applic...
By Encyclopeptide Editorial | 1 min read
yeast-peptides peptide oligopeptide
Overview
YP-011 is a peptide compound with applications in research and therapeutics. AKIGLGYAQKIVNRAQKYKRQIGGPNFNKLCQ
Chemical Identity
| Property | Value |
|---|---|
| Name | YP-011 |
| Sequence | K1 killer toxin (γ-subunit) |
| Length | 27 amino acids |
| Category | Yeast Peptides |
Structure
YP-011 belongs to the Yeast Peptides class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
YP-011 has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: yeast-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about YP-011: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept