Avian Neuropeptide intermediate
Chicken Vasoactive Intestinal Peptide (cVIP)
Comprehensive reference for Chicken Vasoactive Intestinal Peptide (cVIP), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-neuropeptide peptide oligopeptide
Overview
Chicken Vasoactive Intestinal Peptide (cVIP) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Chicken Vasoactive Intestinal Peptide (cVIP) |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Length | 32 amino acids |
| Molecular Weight | 3350 Da |
| Category | Avian Neuropeptide |
Structure
Chicken Vasoactive Intestinal Peptide (cVIP) belongs to the Avian Neuropeptide class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Chicken Vasoactive Intestinal Peptide (cVIP) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Chicken Vasoactive Intestinal Peptide (cVIP) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept