Plant Peptides intermediate
Snakin: Oligopeptide Research Reference
Snakin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Snakin is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Solanum tuberosum (Potato).
Structure
| Property | Value |
|---|---|
| Name | Snakin |
| Sequence | DVCPGVLSNSECCKGWCCRFPCQCRSCHGVPGIGKEGPRCHC |
| Length | 63 amino acids |
| Molecular Weight | ~7,000 Da |
| Source | Solanum tuberosum (Potato) |
| Category | Plant Defense Peptides |
Mechanism of Action
Membrane disruption and microbial agglutination
Bioactivity
Antimicrobial (antibacterial and antifungal)
Therapeutic Potential
Transgenic crop resistance, antimicrobial coatings, agricultural biotechnology
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Snakin: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept