Neuropeptides intermediate
PYY (3-36): Neuropeptide in Neuroscience Reference
PYY (3-36), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
neuropeptides peptide oligopeptide
Overview
PYY (3-36) is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | PYY (3-36) |
| Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Length | 34 amino acids |
| Molecular Weight | 4049.6 Da |
| Category | Neuropeptide Y family / Gut hormone |
Mechanism of Action
Gi-coupled; inhibits adenylyl cyclase, reduces presynaptic neurotransmitter release
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about PYY (3-36): Neuropeptide in Neuroscience Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept