Worm Peptides intermediate
Hirudin HV1: Oligopeptide Research Reference
Hirudin HV1, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
Hirudin HV1 is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hirudo medicinalis (medicinal leech).
Structure
| Property | Value |
|---|---|
| Name | Hirudin HV1 |
| Sequence | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Length | 65 amino acids |
| Molecular Weight | 6960 Da |
| Source | Hirudo medicinalis (medicinal leech) |
| Category | Leech Thrombin Inhibitor |
Mechanism of Action
Bivalent thrombin inhibitor, N-terminal domain blocks active site, C-terminal binds exosite I
Bioactivity
Anticoagulant, prevents platelet aggregation and fibrin formation
Therapeutic Potential
Parenteral anticoagulant, heparin-induced thrombocytopenia treatment
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Hirudin HV1: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept