Worm Peptides intermediate
Lumbricin I: Oligopeptide Research Reference
Lumbricin I, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
Lumbricin I is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Lumbricus terrestris (common earthworm).
Structure
| Property | Value |
|---|---|
| Name | Lumbricin I |
| Sequence | FSRYARMRDSRPWSDRKNNYRPRPRPRPWLPRPRPRPWLPRPRPRPWLPRPRPRPWLPRPRPRPWLPRPRPRPWLPRPRPRPWLPRPRPRP |
| Length | 91 amino acids |
| Molecular Weight | 10950 Da |
| Source | Lumbricus terrestris (common earthworm) |
| Category | Earthworm Antimicrobial Peptide |
Mechanism of Action
Proline-rich antimicrobial peptide, disrupts microbial membranes, inhibits protein synthesis by binding ribosomes
Bioactivity
Broad-spectrum antimicrobial against bacteria and fungi, no hemolytic activity
Therapeutic Potential
Novel antimicrobial drug lead, wound healing applications, anti-infective coatings
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Lumbricin I: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept