Fish Peptides intermediate
Zebrafish NPY: Oligopeptide Research Reference
Zebrafish NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
fish-peptides peptide oligopeptide
Overview
Zebrafish NPY is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Zebrafish (Danio rerio).
Structure
| Property | Value |
|---|---|
| Name | Zebrafish NPY |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Length | 36 amino acids |
| Molecular Weight | 4190.5 Da |
| Source | Zebrafish (Danio rerio) |
| Category | Fish Neuropeptide |
Mechanism of Action
Conserved appetite regulation across vertebrates; modulates feeding, anxiety, and neurogenesis
Bioactivity
Appetite stimulation, anxiolytic effects, neural stem cell regulation
Therapeutic Potential
Model organism for human NPY research, obesity therapeutics, neuroscience research
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Zebrafish NPY: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept