Peptide Hormones intermediate
Chicken Growth Hormone (cGH): Comprehensive Peptide Refer...
Comprehensive reference for Chicken Growth Hormone (cGH), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-peptide-hormone peptide oligopeptide
Overview
Chicken Growth Hormone (cGH) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Chicken Growth Hormone (cGH) |
| Sequence | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSNGSNQESGLLLSIHLLLSKCHTLLRDSYIFRDLQNHLQNTYIKDGFGNQSNQILNFS |
| Length | 93 amino acids |
| Molecular Weight | 22 Da |
| Category | Avian Peptide Hormone |
Structure
Chicken Growth Hormone (cGH) belongs to the Avian Peptide Hormone class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Chicken Growth Hormone (cGH) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Chicken Growth Hormone (cGH): Comprehensive Peptide Refer... with interactive quizzes on Wikipept.
Take a Quiz on Wikipept