Peptide Analogs intermediate
Exenatide (Exendin-4): Oligopeptide Research Reference
Exenatide (Exendin-4), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
peptide-analogs peptide oligopeptide
Overview
Exenatide (Exendin-4) is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Exenatide (Exendin-4) |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Molecular Weight | 4187 Da |
| Category | Metabolic / GLP-1 Agonist |
Mechanism of Action
GLP-1 receptor agonist; resistant to DPP-4 degradation due to Ala at position 2
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Exenatide (Exendin-4): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept