Worm Peptides intermediate
Hirudin HV3: Oligopeptide Research Reference
Hirudin HV3, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
Hirudin HV3 is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hirudo medicinalis (medicinal leech).
Structure
| Property | Value |
|---|---|
| Name | Hirudin HV3 |
| Sequence | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ (sulfated) |
| Length | 65 amino acids |
| Molecular Weight | 7040 Da (with sulfation) |
| Source | Hirudo medicinalis (medicinal leech) |
| Category | Leech Thrombin Inhibitor |
Mechanism of Action
O-sulfated Tyr63 enhances exosite I binding affinity, bivalent inhibition mechanism
Bioactivity
Enhanced anticoagulant potency compared to non-sulfated variants
Therapeutic Potential
Optimized anticoagulant variant, research standard for thrombin inhibition
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Hirudin HV3: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept