Plant Peptides intermediate
Hevein: Oligopeptide Research Reference
Hevein, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Hevein is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hevea brasiliensis (Rubber Tree).
Structure
| Property | Value |
|---|---|
| Name | Hevein |
| Sequence | EQCGRQAGGKLCPNNLCCSQYGWCGSTDDYCSPDHNCQSNCK |
| Length | 43 amino acids |
| Molecular Weight | ~4,700 Da |
| Source | Hevea brasiliensis (Rubber Tree) |
| Category | Plant Defense Peptides |
Mechanism of Action
High-affinity chitin binding inhibits fungal growth
Bioactivity
Antifungal, chitin-binding
Therapeutic Potential
Antifungal agents, latex allergy research, agricultural applications
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Hevein: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept