Worm Peptides intermediate
Lumbricin II: Oligopeptide Research Reference
Lumbricin II, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
Lumbricin II is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Lumbricus terrestris (common earthworm).
Structure
| Property | Value |
|---|---|
| Name | Lumbricin II |
| Sequence | FSRYAMRDSRPWSDRRKKYRPRPSPSPSPRRPRPRPRPR |
| Length | 40 amino acids |
| Molecular Weight | 5100 Da |
| Source | Lumbricus terrestris (common earthworm) |
| Category | Earthworm Antimicrobial Peptide |
Mechanism of Action
Membrane permeabilization, proline-arginine rich antimicrobial peptide
Bioactivity
Antimicrobial against Gram-positive and Gram-negative bacteria
Therapeutic Potential
Antimicrobial peptide template, anti-infective development
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Lumbricin II: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept