Plant Peptides intermediate
Thionin: Oligopeptide Research Reference
Thionin, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
plant-peptides peptide oligopeptide
Overview
Thionin is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Triticum aestivum (Wheat).
Structure
| Property | Value |
|---|---|
| Name | Thionin |
| Sequence | KSCCRNTLARGNVCRRNCRCSGPRPTLSCAGFCRCKYLRCSCK |
| Length | 45 amino acids |
| Molecular Weight | ~5,000 Da |
| Source | Triticum aestivum (Wheat) |
| Category | Plant Defense Peptides |
Mechanism of Action
Disruption of lipid bilayer integrity through pore formation
Bioactivity
Antimicrobial (antibacterial and antifungal)
Therapeutic Potential
Natural food preservative, agricultural biopesticide, novel antibiotic development
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Thionin: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept