Worm Peptides intermediate
Hirudin HV2: Oligopeptide Research Reference
Hirudin HV2, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
Hirudin HV2 is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hirudo medicinalis (medicinal leech).
Structure
| Property | Value |
|---|---|
| Name | Hirudin HV2 |
| Sequence | IITDTCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Length | 65 amino acids |
| Molecular Weight | 6980 Da |
| Source | Hirudo medicinalis (medicinal leech) |
| Category | Leech Thrombin Inhibitor |
Mechanism of Action
Tight-binding competitive thrombin inhibition, blocks both fibrinogen and PAR cleavage
Bioactivity
Anticoagulation, antiplatelet effects
Therapeutic Potential
Anticoagulant drug development, percutaneous coronary intervention
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Hirudin HV2: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept