Neuropeptides intermediate
Neuropeptide B (NPB): Neuropeptide in Neuroscience Reference
Neuropeptide B (NPB), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
neuropeptides peptide oligopeptide
Overview
Neuropeptide B (NPB) is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Neuropeptide B (NPB) |
| Sequence | WYKPAAGGRFYSERLSGRDGAQRGSEEQAL |
| Length | 29 amino acids |
| Molecular Weight | 3346.7 Da |
| Category | Neuropeptide B/W family |
Mechanism of Action
Gi/Go-coupled; inhibits adenylyl cyclase, modulates K+ channels
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Neuropeptide B (NPB): Neuropeptide in Neuroscience Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept