Peptide Hormones intermediate
Chicken Parathyroid Hormone (cPTH)
Comprehensive reference for Chicken Parathyroid Hormone (cPTH), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-peptide-hormone peptide oligopeptide
Overview
Chicken Parathyroid Hormone (cPTH) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Chicken Parathyroid Hormone (cPTH) |
| Sequence | AVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVDVLTKAKSQ-NH2 |
| Length | 88 amino acids |
| Molecular Weight | 9800 Da |
| Category | Avian Peptide Hormone |
Structure
Chicken Parathyroid Hormone (cPTH) belongs to the Avian Peptide Hormone class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Chicken Parathyroid Hormone (cPTH) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Chicken Parathyroid Hormone (cPTH) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept