Avian Cathelicidin intermediate
Duck Cathelicidin (ApCATH)
Comprehensive reference for Duck Cathelicidin (ApCATH), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-cathelicidin peptide oligopeptide
Overview
Duck Cathelicidin (ApCATH) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Duck Cathelicidin (ApCATH) |
| Sequence | RFRKPLRRLFRRIRRFRPKVTITIQGSARFG |
| Length | 31 amino acids |
| Molecular Weight | 3550 Da |
| Category | Avian Cathelicidin |
Structure
Duck Cathelicidin (ApCATH) belongs to the Avian Cathelicidin class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Duck Cathelicidin (ApCATH) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Duck Cathelicidin (ApCATH) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept