Fish Peptides intermediate
Trout NPY: Oligopeptide Research Reference
Trout NPY, a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
fish-peptides peptide oligopeptide
Overview
Trout NPY is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Rainbow trout (Oncorhynchus mykiss).
Structure
| Property | Value |
|---|---|
| Name | Trout NPY |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (amidated) |
| Length | 36 amino acids |
| Molecular Weight | 4200.6 Da |
| Source | Rainbow trout (Oncorhynchus mykiss) |
| Category | Fish Neuropeptide |
Mechanism of Action
Activates orexigenic pathways; stimulates food intake via hypothalamic circuits; modulates energy balance
Bioactivity
Potent appetite stimulant, energy homeostasis regulator
Therapeutic Potential
Obesity research, appetite disorder treatments, aquaculture feed optimization
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Trout NPY: Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept