Worm Peptides intermediate
INS-6 (C. elegans): Oligopeptide Research Reference
INS-6 (C. elegans), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
worm-peptides peptide oligopeptide
Overview
INS-6 (C. elegans) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Caenorhabditis elegans.
Structure
| Property | Value |
|---|---|
| Name | INS-6 (C. elegans) |
| Sequence | MVKIFVLIFFLTVSGHAESIFDRLCGSHLVDALYFICGDRGFYRNKICGSDLVSLWNQ |
| Length | 59 amino acids |
| Molecular Weight | 6520 Da |
| Source | Caenorhabditis elegans |
| Category | Nematode Insulin-like Peptide |
Mechanism of Action
Activates DAF-2 signaling, one of the most potent insulin-like agonists in C. elegans
Bioactivity
Strong promotion of growth and reproductive development
Therapeutic Potential
Insulin signaling research, parasitic nematode target
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about INS-6 (C. elegans): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept