Insect Peptides intermediate
Cecropin D (Hyalophora): Oligopeptide Research Reference
Cecropin D (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
insect-peptides peptide oligopeptide
Overview
Cecropin D (Hyalophora) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hyalophora cecropia (cecropia moth).
Structure
| Property | Value |
|---|---|
| Name | Cecropin D (Hyalophora) |
| Sequence | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK |
| Length | 36 amino acids |
| Molecular Weight | 3760 Da |
| Source | Hyalophora cecropia (cecropia moth) |
| Category | Cecropin / Antimicrobial |
Mechanism of Action
Membrane disruption, forms toroidal pores
Bioactivity
Antimicrobial activity, lower potency than Cecropin A
Therapeutic Potential
Template for synthetic antimicrobial peptide design
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Cecropin D (Hyalophora): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept