Insect Peptides intermediate
Cecropin A (Hyalophora): Oligopeptide Research Reference
Cecropin A (Hyalophora), a bioactive peptide compound with documented applications in biomedical research, pharmacological studies, and therapeutic development
By Encyclopeptide Editorial | 1 min read
insect-peptides peptide oligopeptide
Overview
Cecropin A (Hyalophora) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Hyalophora cecropia (cecropia moth).
Structure
| Property | Value |
|---|---|
| Name | Cecropin A (Hyalophora) |
| Sequence | KWKLFKKIGAVLKVLTTGLPALISWIKRKRQQ |
| Length | 37 amino acids |
| Molecular Weight | 4004 Da |
| Source | Hyalophora cecropia (cecropia moth) |
| Category | Cecropin / Antimicrobial |
Mechanism of Action
Forms voltage-gated ion channels in lipid bilayers, barrel-stave pore model
Bioactivity
Potent broad-spectrum antimicrobial, anticancer activity
Therapeutic Potential
Anti-infective therapy, anticancer peptide drug lead
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Cecropin A (Hyalophora): Oligopeptide Research Reference with interactive quizzes on Wikipept.
Take a Quiz on Wikipept