GLP-1 Family advanced
GLP-1 and Exendin-4 Receptor Cross-Reactivity
Comparison of native GLP-1 and Gila monster exendin-4 at the GLP-1 receptor including binding differences.
By Encyclopeptide Editorial | 1 min read
GLP-1 exendin-4 cross-reactivity receptor comparative
Sequence Comparison
GLP-1(7-36): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Exendin-4: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGP
** **** * ** ** ** ***
Pharmacological Implications
- DPP-4 resistance: Exendin-4 has Gly at position 2
- Half-life: Exendin-4 slightly longer than native GLP-1
- Both activate GLP-1R but not GIPR or glucagon receptor
Chemical Identity
| Property | Value |
|---|---|
| Name | GLP-1 and Exendin-4 Receptor Cross-Reactivity |
| Category | GLP-1 Family |
Biological Significance
This molecule plays important roles in biological systems and has potential therapeutic applications.
References
- Encyclopeptide Database. “GLP-1 and Exendin-4 Receptor Cross-Reactivity” monograph. encyclopeptide.com.
Test Your Knowledge
Reinforce what you learned about GLP-1 and Exendin-4 Receptor Cross-Reactivity with interactive quizzes on Wikipept.
Take a Quiz on Wikipept