Neuropeptides intermediate
Vasoactive Intestinal Peptide (VIP)
Comprehensive reference for Vasoactive Intestinal Peptide (VIP), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
neuropeptides peptide oligopeptide
Overview
Vasoactive Intestinal Peptide (VIP) is a bioactive peptide with well-characterized properties and therapeutic applications.
Structure
| Property | Value |
|---|---|
| Name | Vasoactive Intestinal Peptide (VIP) |
| Sequence | HSDAVFTDNYTRLRRKQMAVKKYLNSILN-NH2 |
| Length | 28 amino acids |
| Molecular Weight | 3325.8 Da |
| Category | VIP/Secretin family |
Mechanism of Action
Gs-coupled; activates adenylyl cyclase, increases cAMP
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Vasoactive Intestinal Peptide (VIP) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept