Neuropeptides intermediate
Chicken Neuropeptide Y (cNPY): Comprehensive Peptide Refe...
Comprehensive reference for Chicken Neuropeptide Y (cNPY), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-neuropeptide peptide oligopeptide
Overview
Chicken Neuropeptide Y (cNPY) is a bioactive peptide with well-characterized properties and therapeutic applications. It is derived from Mammalian (widely conserved).
Structure
| Property | Value |
|---|---|
| Name | Chicken Neuropeptide Y (cNPY) |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Length | 36 amino acids |
| Molecular Weight | 4271.8 Da |
| Source | Mammalian (widely conserved) |
| Category | Mammalian Neuropeptide |
Mechanism of Action
Neuropeptide Y family member, activates G-protein coupled receptors to stimulate appetite
Bioactivity
Potent orexigenic (appetite-stimulating), anxiolytic, vasoconstrictive
Therapeutic Potential
Obesity treatment (antagonists), anxiolytic drugs, cardiovascular therapy
References
- Wikipept Peptide Database
- Primary literature (see individual entries)
Test Your Knowledge
Reinforce what you learned about Chicken Neuropeptide Y (cNPY): Comprehensive Peptide Refe... with interactive quizzes on Wikipept.
Take a Quiz on Wikipept