Avian Neuropeptide intermediate
Chicken Neuropeptide Y (cNPY)
Comprehensive reference for Chicken Neuropeptide Y (cNPY), a peptide compound with applications in research and therapeutics.
By Encyclopeptide Editorial | 1 min read
avian-neuropeptide peptide oligopeptide
Overview
Chicken Neuropeptide Y (cNPY) is a peptide compound with applications in research and therapeutics.
Chemical Identity
| Property | Value |
|---|---|
| Name | Chicken Neuropeptide Y (cNPY) |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Length | 40 amino acids |
| Molecular Weight | 4250 Da |
| Category | Avian Neuropeptide |
Structure
Chicken Neuropeptide Y (cNPY) belongs to the Avian Neuropeptide class of peptides. Its structure and properties make it suitable for various research and therapeutic applications.
Applications
Chicken Neuropeptide Y (cNPY) has been studied for its potential applications in:
- Biomedical research
- Drug discovery
- Diagnostic applications
- Therapeutic development
References
- Source: bird-peptides.md
- Database: Wikipept Peptide Database
Test Your Knowledge
Reinforce what you learned about Chicken Neuropeptide Y (cNPY) with interactive quizzes on Wikipept.
Take a Quiz on Wikipept